(data stored in ACNUC7421 zone)

EMBL: CP000675.PE621

CP000675.PE621       Location/Qualifiers
FT   CDS_pept        655647..655844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2780"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56682"
FT                   /protein_id="ABQ56682.1"
FT                   /translation="MEKRVFKEAEAANYICMSRSFLSQDRVNGTLANRTPGPKYIKIGR
FT                   SIRYLKDDLDAWLEQHRKCG"
     gtggagaaga gagtctttaa agaagctgaa gctgctaact atatatgcat gagccgttct        60
     tttctttctc aagacagggt aaatggaact ttagctaata gaactccagg ccctaaatat       120
     attaaaatcg gacgatcaat acgctatttg aaggatgacc ttgatgcatg gttggaacaa       180
     cacaggaagt gtggttag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page