(data stored in ACNUC7421 zone)

EMBL: CP000675.PE624

CP000675.PE624       Location/Qualifiers
FT   CDS_pept        complement(657772..658149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2776"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56679"
FT                   /protein_id="ABQ56679.1"
FT                   /translation="MFFIKYLGALIYDLIILFILFFAYTSVLLLFTHGQAIPPATRWYQ
FT                   FSLLSITLVYYYGSIRCGGQTVGMKAWRFKLTTDSNKTLSRQQIIARFFYFIPATLIAP
FT                   FCLKGNYVLLHQWTQTRFKKV"
     atgtttttca tcaaatactt aggtgcattg atttatgatt taatcatctt attcatttta        60
     ttttttgcat acacctctgt cctgctatta ttcacccatg gacaagccat acctcctgcc       120
     acccgttggt atcaattttc attactcagt atcactcttg tttattatta tggttctatt       180
     cgctgtggtg gacagactgt aggtatgaaa gcctggagat ttaagctcac aactgattct       240
     aataaaacac tatcaagaca acaaattatc gcccgatttt tttattttat tcctgccacc       300
     ttaatagcac ctttttgctt aaaggggaat tatgtgcttt tgcatcaatg gacccaaacg       360
     cgttttaaaa aagtttaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page