(data stored in ACNUC7421 zone)

EMBL: CP000675.PE625

CP000675.PE625       Location/Qualifiers
FT   CDS_pept        complement(658299..659438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2775"
FT                   /product="Predicted signal transduction protein containing
FT                   EAL and modified HD-GYP domains"
FT                   /note="COG3434"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2775"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56678"
FT                   /protein_id="ABQ56678.1"
FT                   /translation="MIAKRPIYNQQLKCVAFEILSCRNVILNEELTRQFYELIYHTDTQ
FT                   LPLFVPFSLKKLLEQFETPINNPIILKLPADEIESVYSLTELQDSLFSIALLINTPQQL
FT                   AWLNFAEYIGLTEQLMNKSDVTKVVQYSKAKNRKIIAYDLNQHVNFEKCRAMTMDYYCG
FT                   DFLLNYIAEEHTEIAANKLNVLQLIQELQKEDCDLNTITHIIQEDPLLSYQLLKLVNSV
FT                   GFSSGPSIESIDQAVARLGTINLKKWVMLFSMKNISDKPVEILESGLIRAHMAEELAKK
FT                   SSNIFSQSAYTAGLLSILDCLLNKPMPALVEQITLAEEIKNALTNKSGPLGNLLSLVIA
FT                   YEEGHWEEVTQLNINGIDLSQLYIDSLALVSQGTKIMSN"
     atgatcgcca aaagaccaat atataatcaa caattaaaat gtgtcgcctt tgaaatatta        60
     tcctgtcgca atgtaatact taatgaagaa ttaacaaggc aattttatga gctcatttac       120
     cacacagaca cccaattacc tctatttgtt cctttttccc taaaaaaatt gcttgagcaa       180
     tttgagacgc caatcaacaa ccccattatt ttaaaattac ccgcagatga aatcgaatcg       240
     gtttattcac taactgagct acaagactct ctattttcta ttgccttact gattaatacc       300
     cctcaacaat tggcttggct aaattttgcc gaatacatag gattgactga gcagttaatg       360
     aataaatcgg atgtaaccaa ggtagtacaa tacagtaagg caaaaaatcg taaaatcatt       420
     gcttatgatc taaatcaaca cgttaatttt gaaaaatgta gggctatgac gatggattat       480
     tactgtggcg atttcctgct taactacatt gcagaggagc acacagaaat agcagcaaac       540
     aaattaaatg tacttcaact catccaggaa ttacaaaaag aagattgcga tttaaacacg       600
     attactcata tcatccaaga agatccatta ctaagctatc aacttctaaa actggtcaat       660
     tcagttggat tttctagtgg accaagcata gaatccatcg atcaagccgt tgccaggctt       720
     ggcaccatta acctgaaaaa atgggttatg ctgttttcaa tgaaaaatat ctcagataaa       780
     cctgtagaaa tattggagtc aggtctaatc agagctcata tggcggaaga gctcgctaaa       840
     aaaagttcga atattttcag ccaaagtgcc tatactgcag gattattatc catattagac       900
     tgcttattaa acaaacccat gccagcattg gtagaacaaa tcaccctagc tgaggagata       960
     aaaaatgctc tgacaaataa atcaggacca ttaggaaatc tattgtcttt ggtaattgct      1020
     tatgaagaag ggcattggga agaagtaact caacttaaca tcaatggaat tgatttaagt      1080
     caattatata ttgacagttt agccttggta agccaaggta caaaaatcat gagtaactga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page