(data stored in ACNUC7421 zone)

EMBL: CP000675.PE637

CP000675.PE637       Location/Qualifiers
FT   CDS_pept        complement(672046..672156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2763"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56666"
FT                   /protein_id="ABQ56666.1"
FT                   /translation="MTELKIFFNQEIGVFGYPVDEFKTKLNNPRGFTKKF"
     atgaccgaat taaaaatatt ttttaaccaa gagattggag ttttcggata tccagtggat        60
     gagttcaaaa caaaactgaa taatccccga gggttcacca agaagtttta a                111
//

If you have problems or comments...

PBIL Back to PBIL home page