(data stored in ACNUC7421 zone)

EMBL: CP000675.PE64

CP000675.PE64        Location/Qualifiers
FT   CDS_pept        64230..64505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54064"
FT                   /protein_id="ABQ54064.1"
FT                   /translation="MGMLTQLKNGFIPVFIVMSSLGYWMGIGEMGSELVVKVTPGHGFR
FT                   PPPRLLKSCSTIFKIFNQIIITAMLSFEPALSNQYQVQCMRSYINR"
     atgggtatgc tgacacagct aaagaatggc tttattcctg ttttcatcgt catgtccagt        60
     ctgggttatt ggatgggaat tggcgagatg gggagtgaat tagtggtaaa ggtaactcca       120
     ggacacgggt ttcgccctcc tcccaggttg ctaaagtctt gcagcacaat attcaaaatt       180
     ttcaaccaaa ttatcattac agctatgctt tcattcgagc cagccttgtc caatcagtat       240
     caagtgcaat gcatgaggag ctacattaat agataa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page