(data stored in ACNUC7421 zone)

EMBL: CP000675.PE640

CP000675.PE640       Location/Qualifiers
FT   CDS_pept        675199..676656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2759"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5339"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2759"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56663"
FT                   /protein_id="ABQ56663.1"
FT                   /translation="MKKLTGLVIILAVLILGGYYGMGILTERTVKKTVEVINQSNGLFA
FT                   DIQQYKRGWFCSDALVKWRLHVPERVVKDDDGKLQTTPAQDYQMEMPIKIYHGPIIYAN
FT                   KQLRFGMGFAQTVFPFPEKYNQQFNELFSQDSEKPQLDLSIFVNYLNKSTVELSIPSFK
FT                   LTAKDGNGKFNWMGMDSTTSMSSNLDKVEGEIEFDGAEFSKDDTKLSLGKVISEYDLHK
FT                   TTTGLYLGQASFSLPSLAVVVKDQKMFEISELTLSSSSDIDDNLFSTHFSAALKSLFAN
FT                   GQNYGPGEVEMSLRNLDAEVLAKINEQANAMQRGTDQERQQALMAMLPELPKLFSKGAE
FT                   FEISKLSLKLPQGMIDGNLLITLPKGDNSNPFELIQKTQGNAKLKMPIEVVKQLMQQSI
FT                   MQQMAKQPEMQQALIQQLQSSQGQSNQAEPTPEQIAAMQVDKQINELEQSGLITVDGKD
FT                   YVIEMSLSEGKFTVNGKPFDPSMMKFQ"
     atgaaaaaac ttacaggatt agtaattatc ctggctgttt taatcctagg tggatattat        60
     ggcatgggaa ttctaaccga aagaacggtt aaaaaaactg tcgaggtaat taatcaatcc       120
     aatgggcttt tcgctgacat tcagcaatat aagagaggtt ggttttgctc tgatgcatta       180
     gttaaatggc gtttacacgt acctgagcga gtagtaaagg acgatgatgg aaaattgcaa       240
     actactcctg cccaagatta tcaaatggaa atgccgatta agatttatca tggccccatt       300
     atatacgcga ataagcagtt acgttttgga atgggctttg cacaaaccgt atttccattt       360
     ccagaaaaat ataatcagca attcaatgag cttttttctc aagattcaga aaagcctcag       420
     ctggatttga gcatttttgt aaattatttg aataaaagca cggtggagtt gtccattcct       480
     tctttcaaat taactgctaa agatggaaat ggtaaattta attggatggg tatggacagc       540
     actacatcaa tgtcttccaa tttggataaa gtggaagggg aaattgaatt tgatggtgca       600
     gagttttcta aagatgatac caagctctct ttgggtaagg taatcagcga gtatgactta       660
     cataaaacga ctacagggtt atatttgggt caagccagtt tttcattacc atcacttgct       720
     gtagttgtta aagatcaaaa gatgtttgaa attagtgaat tgacattaag ctcaagcagc       780
     gatatagatg acaatctctt cagcacgcat tttagtgccg ctttaaaatc gttattcgcc       840
     aatgggcaaa attacggtcc tggtgaagtc gagatgtcct taagaaacct tgatgctgaa       900
     gtactggcta aaatcaatga acaagctaat gcgatgcaaa gaggcacaga tcaagagcgc       960
     caacaagcat taatggcaat gttgccagaa ttgccaaagc tatttagtaa aggtgcagag      1020
     tttgaaattt ccaaattaag tctcaaactt ccacaaggca tgattgatgg taacttgtta      1080
     attactttac ccaaaggcga taattctaat ccctttgaat tgattcaaaa aactcaaggt      1140
     aatgccaagt taaaaatgcc aatcgaggta gtgaagcaac tgatgcagca atcgattatg      1200
     caacaaatgg caaaacagcc agaaatgcaa caagcgttaa ttcaacagct gcaaagcagt      1260
     caaggtcaat caaaccaagc agaacctact cctgagcaaa tcgctgcaat gcaagtagat      1320
     aagcaaatta atgagttgga gcaatctggt ttaattactg tcgatggcaa agactatgtc      1380
     attgagatga gtttgagtga aggaaaattc acagttaatg ggaaaccatt tgatccgtct      1440
     atgatgaaat tccagtag                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page