(data stored in ACNUC7421 zone)

EMBL: CP000675.PE647

CP000675.PE647       Location/Qualifiers
FT   CDS_pept        complement(681498..683714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2750"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56656"
FT                   /protein_id="ABQ56656.1"
FT                   /translation="MSINKIEEDRDTSSDLEMKAKMYLVHRMDKARPLTVKDVHILINK
FT                   LSKDLQKNQLTLIDCQLIINLVESRFTLVKQATRYLQFFLNKLDGKSINPILIPLSNIP
FT                   FWQNEPHPFDHYRSTDQLPEKADIVIIGAGLTGASTAYHLIDAVKKRNLTVVLLDKGNP
FT                   ATEASGRNGGNFELLPENSVGIYSGLVSERFRFLKRCYPLVHPSILQIESEYHASLVFQ
FT                   FALKNRNRFKEIVRKERIYCDLAAKGWLYIAHTEEEEQAICDEVTLAAQHGERIYIWSR
FT                   KKIREQFGINSKFIGRFIPDDGTYNPFKYTCCLIKAAIKGGIKLYTFVKVQQIQSMDTE
FT                   YHQLKTNMGLLKARQVIVATNAFTSELLPELSAIKPHQSQIAITDSTPDYCKGRLITSE
FT                   DGPLYLNQPRVRSKNGLVPLLIGAGDDRPMKNPYYRKRSKKVHDLIVQQRDKYFPDLKG
FT                   KPFSTEWVGALAFTPDQLPAIGYLSPGIIIVMCCNGYGGSYTTAAGFAAAEIALTGQNP
FT                   PWLPADVFSPKRLLSDKPLFLEDSDSLWRIGKTLCTTLNNLNQLLAESLSYQSMYQPYF
FT                   TISSLPHGHQEKTCNLDPLRVMHQLAIFRTFAYQELEMLIRYTSPVCLNKGEILFKQGD
FT                   AGHSCFILIQGKINLYYEHAEGFTSMVAELEAGSVFGQMALFLENKRMATCQATENCSM
FT                   LEIMVEPCKSLFIQQQALGIKLLRLLNQGVIDALHKLNKRLKYT"
     atgagcatta ataaaataga agaagacagg gatacctctt ctgatctgga aatgaaagcc        60
     aagatgtact tagtacaccg aatggataaa gccaggccat taacagttaa agatgttcac       120
     atcctgataa acaagttaag taaagatttg cagaaaaatc aattaacatt aattgattgt       180
     caactaataa taaatcttgt tgaatctcgc tttactttgg tcaaacaagc aacaagatat       240
     ctacagtttt ttctaaataa acttgatggc aaatcaatta acccaatctt aatcccactt       300
     tcaaatatac ccttttggca aaatgaacca catccattcg atcattatcg atctaccgat       360
     caactacctg aaaaagcaga tatcgtaatc ataggtgcag gtctaactgg cgcttctacc       420
     gcatatcatc tgatcgatgc agttaagaaa agaaatctta ctgttgtatt gttagataaa       480
     ggaaatccag ccactgaagc cagtggtcgc aatgggggta attttgaatt attacctgaa       540
     aactctgtgg gaatctatag tggtttagtc tcagagcggt ttcgtttttt aaaacgatgc       600
     tacccccttg ttcatccgtc aatattacaa attgaaagcg aataccatgc ctcgctggtt       660
     tttcaatttg ctttaaaaaa tcgtaatcgc tttaaggaaa ttgtcagaaa agaacgtatt       720
     tattgtgatc tggcagcaaa aggatggctc tacattgctc atactgaaga ggaagaacaa       780
     gcaatttgtg atgaagtcac tctggctgcc caacatggtg agcgcatcta catttggtct       840
     cgaaaaaaaa ttagagaaca atttggcatc aactccaagt tcataggtcg atttattcca       900
     gatgacggca cctacaatcc ctttaaatat acgtgctgtc tgattaaggc ggcaatcaaa       960
     ggtggtatca agctctatac gtttgtgaaa gttcaacaaa ttcagagtat ggatacagaa      1020
     taccatcaat tgaaaaccaa tatgggtttg cttaaggctc ggcaagtgat tgttgcaaca      1080
     aacgcattta ctagtgagtt gctcccggaa ttgagcgcga ttaagcctca ccaaagtcaa      1140
     attgcaatta ccgattcaac accagattac tgtaagggtc gattaataac tagcgaagat      1200
     ggaccgctct atctcaatca acccagagtc agatcaaaga atgggttggt gccattgctt      1260
     attggtgccg gtgacgaccg accaatgaaa aacccttatt atcgcaagcg ttcaaaaaaa      1320
     gttcatgatc ttattgtgca gcaaagagat aagtatttcc cggaccttaa agggaaacca      1380
     ttttcaaccg agtgggttgg cgccttagct tttacacctg atcaattacc cgctattggt      1440
     tacctgtctc caggaataat tattgtgatg tgctgtaatg gatatggagg aagctatacc      1500
     acagcagcag gatttgccgc agctgaaatt gcattaactg gacaaaatcc cccatggcta      1560
     cccgcagatg tattttctcc taaacgcctc ctgtcagaca agccactatt tttggaagat      1620
     agtgacagtt tatggcggat tggaaaaaca ctttgtacaa cacttaataa tctcaatcaa      1680
     cttctggctg agtccctttc atatcagtcc atgtatcaac cttattttac aatttcttca      1740
     ttaccgcatg ggcaccaaga gaagacttgc aatcttgacc cactaagagt aatgcatcaa      1800
     ttagcaatct ttagaacttt tgcctatcag gaattagaaa tgttaattcg ctatacctcg      1860
     cctgtttgct taaataaggg agaaattctt tttaaacaag gtgatgcggg acattcttgt      1920
     tttattctga ttcaaggaaa aatcaatctt tattatgagc atgctgaagg ctttacttca      1980
     atggttgcag aactggaggc cggatcagta tttggtcaaa tggcattatt tcttgagaat      2040
     aaacgtatgg ccacttgcca agctacagag aactgttcca tgttagaaat catggtagaa      2100
     ccctgtaaat cgctttttat tcagcaacag gctcttggaa ttaaattact ccgcctctta      2160
     aaccagggag tcatcgatgc gttacacaaa ctcaataagc gattgaaata cacttaa         2217
//

If you have problems or comments...

PBIL Back to PBIL home page