(data stored in ACNUC7421 zone)

EMBL: CP000675.PE65

CP000675.PE65        Location/Qualifiers
FT   CDS_pept        64639..65886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0065"
FT                   /product="SdbB protein (putative substrate of the Dot/Icm
FT                   system)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54065"
FT                   /protein_id="ABQ54065.1"
FT                   /translation="MTRSKESKTENSSFFQNHLKLSVAKLLFSEGVGDWYKKKGYGAQD
FT                   TDKDFLAPFADFLKQQKTNPEATYYNAFQNLKLTLNRVPSQLVSRDSCELEVLTCEPEA
FT                   DSPQKTGTGKHIVYFPGANTYYQACFRDISAAAKETGATVHALNYPGIGMSTGEVVEAN
FT                   DLTNAGIAVVLSLLNQGVKPDDIVLQGDCFGASVALEVKNEIEKQADIKVRLIMNNAFK
FT                   SFKAAVSDLIDRSPLIPSVSKSIVKNLLEFTGWNVAPGQKYIHSDPYQCYIQHEGDQTL
FT                   TTATLSSKVAKYKEEIRTGRTTSRSRDPVIDKCPEEYKPFRDFLDENCFVRVRDSAKER
FT                   LAAKFGVDSCGEVNAHFADLCELEMLGGQSVYEGFVNNYLVMSDKYIKAHPQKDYDPDK
FT                   INFLSSNPMGYTPKSS"
     atgactagaa gtaaagagtc aaagacagaa aatagttcat tctttcagaa tcatttgaag        60
     ctctctgttg ccaaattatt gttctcagag ggagtgggag attggtataa aaaaaagggt       120
     tatggagctc aagacacgga taaggatttc ttggcaccat ttgctgattt tcttaagcaa       180
     caaaaaacca atcctgaagc cacttattat aacgcattcc agaatcttaa attaacatta       240
     aaccgagtac cctctcaatt ggtttcaagg gattcgtgtg aattggaagt tctgacatgc       300
     gaaccagaag cagattctcc tcaaaaaacg ggcactggta aacacattgt gtattttcct       360
     ggcgcaaata cctactatca ggcttgcttt cgagatatca gcgctgcagc aaaagaaacc       420
     ggagcaacgg tacacgcgct caattaccca ggcatcggga tgagtactgg agaagttgtg       480
     gaagctaatg atttaaccaa cgccggtatt gcagtggttc tatctttatt aaatcagggc       540
     gtcaagccag atgatattgt tttgcaaggc gattgttttg gggcatccgt tgcactggag       600
     gtaaaaaatg agattgagaa gcaagcggat ataaaagtac gactgataat gaataatgca       660
     tttaaatcgt ttaaagcagc tgtttctgat ttaattgaca gatcgccttt aattccctcg       720
     gtatcaaaat ccattgttaa aaatttgctg gaatttaccg gatggaacgt tgcccctggg       780
     caaaagtata tccattcaga tccctaccag tgttatattc agcatgaggg ggatcaaacc       840
     ttaaccaccg cgactttatc ctccaaggtc gctaaataca aagaggaaat aagaacaggg       900
     agaaccacat cccgctcaag agatcctgtt attgataaat gccctgaaga atacaaacca       960
     tttcgtgact ttcttgatga gaattgtttt gtcagagtta gagattctgc aaaagaacgg      1020
     ttagctgcta aatttggtgt ggacagctgc ggtgaggtga atgcccattt tgccgatctt      1080
     tgtgaattgg aaatgctggg agggcaatcg gtctatgaag gatttgttaa taactattta      1140
     gtcatgtcag ataaatacat aaaagcacac cctcaaaagg attatgatcc tgataaaatt      1200
     aattttcttt cttctaatcc tatgggctat accccaaaat caagttaa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page