(data stored in ACNUC7421 zone)

EMBL: CP000675.PE654

CP000675.PE654       Location/Qualifiers
FT   CDS_pept        complement(688911..689141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2742"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56649"
FT                   /protein_id="ABQ56649.1"
FT                   /translation="MSDKVQKLIENIVPFIVIGVGIAIVVALLFMFFYVAIWGVIIGGI
FT                   LWLGALAKEYFFPSKSSQKEQGRIIEHDDKK"
     atgagcgata aagttcagaa attgattgaa aatattgtgc cttttatagt gattggtgtt        60
     gggattgcaa tagttgtagc cttattgttc atgttttttt atgtggctat ttggggcgta       120
     atcatcggtg gaatactctg gcttggggcc ttagctaagg aatatttctt ccccagtaaa       180
     tcatcccaaa aagaacaagg aagaattata gaacatgatg ataaaaaata a                231
//

If you have problems or comments...

PBIL Back to PBIL home page