(data stored in ACNUC7421 zone)

EMBL: CP000675.PE656

CP000675.PE656       Location/Qualifiers
FT   CDS_pept        complement(690550..690948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2740"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56647"
FT                   /protein_id="ABQ56647.1"
FT                   /translation="MFNKFLVTTLSVVTLTLSPYGFAKDDSCEVQVAVSTPPVQFDQSV
FT                   AFNVTNDDGISKSIILQGGSSPKTIGKLICSPLPYTISATQYFTPTGLTNRHAQPVGQC
FT                   VLKAGNVILNGSNNSVAVVFPNDFICHH"
     atgtttaata aatttttagt tacaacacta tccgtagtca cattgacact ttcaccatat        60
     ggttttgcca aagatgattc atgcgaagtt caagtcgctg tttccactcc ccctgttcaa       120
     tttgatcaaa gtgtggcgtt taacgtaacg aatgatgatg ggattagtaa atccattatt       180
     ttacaaggcg gaagcagtcc aaaaactata gggaaattaa tttgttctcc actaccttat       240
     accattagcg ccacccaata ttttacacca acaggcttaa ccaataggca tgctcaacct       300
     gttggccaat gcgtattaaa agctggaaat gtcatattga atggttctaa caatagcgtt       360
     gctgttgttt tccccaatga ttttatatgc caccactaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page