(data stored in ACNUC7421 zone)

EMBL: CP000675.PE659

CP000675.PE659       Location/Qualifiers
FT   CDS_pept        693008..693406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2737"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2737"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56644"
FT                   /protein_id="ABQ56644.1"
FT                   /translation="MTRLIKKYKNRRLYDTEISQYITVEQLQKYVVDGIDFKIEDSETG
FT                   KDLTNSVLLQIIVEMEAGPTQFLSSEILRQIISLANHPMHVSFKEMMEQMFHAMDKPLQ
FT                   NNPYQQATDVWNKQMQQMVHQWQKMFKV"
     atgactcgac tcataaaaaa atacaaaaat cgaagactat atgatactga aattagtcaa        60
     tatattaccg ttgagcaact acaaaagtat gttgtggatg gtattgattt caagatagaa       120
     gattcagaga caggaaagga tttaactaat tcggttctgt tacaaattat agtggaaatg       180
     gaggctggtc caacgcaatt tttgtcttca gaaattttac gccaaatcat ttcattagct       240
     aatcatccaa tgcatgtttc ctttaaggaa atgatggaac aaatgtttca tgcaatggac       300
     aaacctttac aaaacaatcc ttaccagcaa gcgactgatg tctggaataa gcaaatgcaa       360
     caaatggtac atcaatggca aaaaatgttt aaagtctaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page