(data stored in ACNUC7421 zone)

EMBL: CP000675.PE661

CP000675.PE661       Location/Qualifiers
FT   CDS_pept        complement(694148..695218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2735"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56642"
FT                   /protein_id="ABQ56642.1"
FT                   /translation="MKHTYNPFRYLIYFAFFITSLSSYSSQTTNIKEQTDTGLAPPAPS
FT                   ITTNSAAIEEQANSSIRKLYHTLNTMPNTSMADRISQISAYFKGTKYILGSLGEGPNAR
FT                   YDQFPRYRVDGFDCDTYVNTVLSLALANSLESFQECLKHTRYKNGKRSYINRNHFTSID
FT                   WNNYNQKRGLLKDITFSIRNEKKQPVALYANALINKPQWYNHKTIDTIRLQKQDKNEQE
FT                   KRLVELKAKGKKLETSLSNVPYIPFTALFSENKPNLHLFSQIPNGAVIEIIRPNWDLRQ
FT                   QIGTELDISHLGFAIWINNELFFRQASSQYGKVVDVSLIDYLDKARSSPTIKGINIQIV
FT                   LPEKPVSNGCQLFDIR"
     atgaaacata cttacaatcc cttcagatac ttaatatatt tcgctttttt tatcaccagc        60
     ctttccagtt atagcagcca aacaaccaac attaaggaac aaactgatac aggtttagcc       120
     ccacccgccc cttcgattac cactaactca gctgctattg aagaacaggc gaattcttca       180
     attaggaaac tatatcatac actcaatacc atgccgaaca cttctatggc agatagaatt       240
     agccagatca gcgcatattt taaagggaca aaatatattc ttggctcttt gggcgaaggt       300
     ccaaatgctc gttatgatca atttcccaga tatcgagttg atggctttga ttgtgatacc       360
     tatgtcaata cagtactttc tctagcatta gctaactctc ttgaatcatt ccaggagtgt       420
     ttaaaacata ctcgctataa aaatggaaaa agatcttata tcaacagaaa tcattttacc       480
     tctatagact ggaataacta taatcagaag agaggtttac ttaaagacat taccttctct       540
     atcagaaatg aaaaaaagca gcctgttgct ctttatgcta atgccttaat caacaaacca       600
     caatggtata atcataaaac gatcgatacc attcgattgc aaaaacaaga taaaaatgaa       660
     caggaaaaac gtcttgtgga actaaaagcc aaaggtaaaa agttggaaac ttctctttct       720
     aatgtccctt atattccatt cactgcctta ttttcagaga ataaacctaa cctgcattta       780
     ttttcccaaa ttcctaacgg agctgttatt gaaatcatca gacctaattg ggacttacgc       840
     caacaaatag ggacagaatt agatatttcg catttaggct ttgctatttg gattaataac       900
     gaactgtttt ttcgacaagc ctcttcccaa tatggtaaag tagttgatgt atccttgatt       960
     gattaccttg ataaagcacg cagtagccca actataaaag ggattaatat tcagattgta      1020
     ttgcctgaaa aaccagtatc taatgggtgc cagctttttg atattcgata g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page