(data stored in ACNUC7421 zone)

EMBL: CP000675.PE670

CP000675.PE670       Location/Qualifiers
FT   CDS_pept        709682..709867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2722"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56633"
FT                   /protein_id="ABQ56633.1"
FT                   /translation="MNTDDINKAYVSPYDKFLYEFDATHKKSASQLQEIKKHERIFKMR
FT                   DDKDYKIDQSEIWEEF"
     atgaacaccg atgatataaa taaagcttat gtcagtcctt acgataagtt tttatatgaa        60
     tttgatgcga cacataaaaa atcagcatcg caattgcaag aaattaaaaa gcatgagcgt       120
     atattcaaaa tgagagatga taaagactac aagatcgatc aaagtgaaat ttgggaagag       180
     ttttaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page