(data stored in ACNUC7421 zone)

EMBL: CP000675.PE674

CP000675.PE674       Location/Qualifiers
FT   CDS_pept        712578..713342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2718"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae; Secretin_N, Bacterial type II/III secretion
FT                   system short domain pfam03958"
FT                   /note="pfam03958"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2718"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56629"
FT                   /protein_id="ABQ56629.1"
FT                   /translation="MIKRWLLVILLISGNAFSQQMITKVIELNYLQADKVIQLIQPLLQ
FT                   TDEKVSGSGQTLIVNVSPQTLTQIRNVLHKIDVPPVVFNITVYQGDPEWLSSQDGNDVV
FT                   YSTQPQYEVQRSQSVKVMSGESAFVATGEQVPVVTSVGVGLLATGVSYEQHNIQNGLLV
FT                   HPVLQGSQVKLTVRRVREQENVESDQQFDNQQIDTTIMAPLNKWVPLGTAEGVQNTDSS
FT                   STSYTAGRPFSQNSTLYIKVSVVKSTPSGTTK"
     atgattaagc gatggctatt agtgatatta ttgatttctg gcaacgcttt ttcccagcag        60
     atgataacca aggttatcga attgaattat ttgcaagcag ataaggttat tcagttaatc       120
     caaccattat tgcagactga tgagaaagta agtggttcag ggcaaacact aattgttaat       180
     gtgagtcccc aaactttaac gcaaatcaga aacgtattac ataaaataga tgttcctcct       240
     gttgttttta atattactgt ttatcaaggg gatcctgaat ggttaagctc acaggatggg       300
     aatgatgtcg tttacagcac acaaccacaa tacgaagtgc agcgcagtca atccgttaaa       360
     gtcatgagtg gggaatccgc ttttgttgcg accggtgaac aagtaccagt agttacttca       420
     gttggtgttg gtcttttagc cacaggagta tcttatgagc agcataatat ccaaaacggt       480
     ttgctagtac atcctgtttt gcaaggatca caggtcaaat tgacggtgag aagagtgcga       540
     gagcaggaaa atgtagagag tgatcaacaa tttgataatc aacaaataga tactacgatc       600
     atggcgccat tgaataaatg ggttccatta ggtacagcag agggggttca aaataccgat       660
     tcttcttcaa cttcttatac agctggaagg cctttttctc aaaattcaac tttatacatt       720
     aaggtatcag ttgtaaaatc caccccttct gggaccacca aataa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page