(data stored in ACNUC7421 zone)

EMBL: CP000675.PE678

CP000675.PE678       Location/Qualifiers
FT   CDS_pept        complement(715609..715935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2714"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56625"
FT                   /protein_id="ABQ56625.1"
FT                   /translation="MADQYTDTALSLLSQCYDASDEINSNITHCFNEKLKKIPNPLNYK
FT                   ISVHATKTKKSDHGKITVFMINNKGIMLYCIGTAGEKLKINACASDVGKPLTPEQELSI
FT                   EGFF"
     atggcagatc aatatacaga cactgcctta tcgctgttat cacaatgcta tgatgcgtca        60
     gatgaaatta attcaaatat tactcattgc tttaatgaaa aactaaaaaa aatccctaat       120
     cctttaaatt ataaaattag cgtccatgct acgaaaacaa aaaaatctga tcatgggaaa       180
     ataacagttt ttatgataaa taataaagga attatgcttt attgcatcgg cactgcaggg       240
     gaaaaactaa aaataaatgc ctgtgcttct gatgtaggca agccacttac tcccgaacaa       300
     gaattgtcaa ttgagggctt cttttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page