(data stored in ACNUC7421 zone)

EMBL: CP000675.PE681

CP000675.PE681       Location/Qualifiers
FT   CDS_pept        complement(718292..718546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2711"
FT                   /product="conserved hypothetical protein"
FT                   /note="pfam04380"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2711"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56622"
FT                   /protein_id="ABQ56622.1"
FT                   /translation="MFDPKQFDELANKLFATLPTSLQNFEKDIQQKFKEVLQSTFSRMD
FT                   LVTREEFDVQCKVLARTREKLEQLQHQLEDFIKRQEIKK"
     atgtttgacc ccaagcaatt tgatgaatta gctaataagc ttttcgctac tttacctacg        60
     agtctacaaa attttgaaaa agacattcaa caaaaattta aagaagtact gcaatcaaca       120
     ttcagccgaa tggaccttgt tacccgtgaa gaatttgatg tgcaatgtaa agtacttgcc       180
     agaactcgag aaaaactgga gcaattgcag caccagcttg aagacttcat taaacggcaa       240
     gaaattaaaa aataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page