(data stored in ACNUC7421 zone)

EMBL: CP000675.PE688

CP000675.PE688       Location/Qualifiers
FT   CDS_pept        723432..724973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2703"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56615"
FT                   /protein_id="ABQ56615.1"
FT                   /translation="MLPFLSLFFRQLYRIHVKIEDNNRIPLTYRQFLTRCFILGRQIKK
FT                   QTAIGETVGVMMPTTIAGMVTFFALQAYRRIPAMLNFSMGFYNLYSACNTARIKSIYTA
FT                   RQFIETAKLEPLVEELQQAGIRIHYLEDFKSTIHLGNKLSGIFKGFFPTLSYRFLGDKI
FT                   SPDTTGIILFTSGSEGKPKGVALSHANILANCWQMTSRVDFTPRDVLFNSLPIFHCFGL
FT                   TAGSVLPLVNGLNCFFYPSPLHYKVIPGLVYQTGATILFGTDTFLTGYARAAGKHDFNS
FT                   VRYIFAGAEKVKPETIRYWSEAFGARIYEGYGATEASPVISLNCPLASVPGSVGMILPF
FT                   MDFKVEPVEGIVQGGRLKLCGPNIMLGYLDEDKPGVIIEPEDGWHDTGDIVTVNADGFI
FT                   TIAGRAKRFAKIAGEMVSLTAVEGIAASIWPELLHAAVVQKSPRKGEQIFLFTEAEYAD
FT                   KVSFIKKVKERGQSELLVPHMIYPACQIPVLPSGKIDYITLEKQFLEQKETMETV"
     atgttaccat tcttaagttt gttttttaga cagttatatc gaattcacgt taaaatagaa        60
     gacaataatc gtattccctt aacttacaga cagttcttga ctcgttgttt tattctgggg       120
     cgccaaatta aaaagcaaac ggctataggc gaaacggtcg gagtaatgat gccgactact       180
     atagctggca tggtcacttt ttttgcttta caagcttata gacgaatacc tgccatgttg       240
     aattttagca tgggttttta taacttatat tcagcctgta atacagcaag aattaaatca       300
     atttatactg caaggcaatt catagaaacc gccaaattag aacccttggt agaagagttg       360
     caacaggcgg gtataagaat tcattattta gaagatttta aatcaactat tcatttaggt       420
     aacaagcttt ccgggatatt caaaggcttc tttcccactc taagctaccg ttttcttggt       480
     gacaaaatat cccctgatac aacaggcata atcctgttta cctctggttc tgagggaaaa       540
     cccaaagggg ttgctcttag ccatgccaat atattggcta attgttggca aatgacttcc       600
     agagtcgact ttactccacg agatgtttta tttaattcct tacctatatt ccattgtttt       660
     ggccttacag caggaagtgt gcttcctttg gttaatggtt tgaattgttt tttctatcct       720
     tcccctcttc attataaggt aattcctgga ttggtttatc aaacaggggc tactattttg       780
     tttggcacag atactttttt aacgggttat gcaagggccg cgggcaaaca tgatttcaac       840
     agcgtccgct atatcttcgc tggcgccgag aaagtgaaac cggaaaccat tagatactgg       900
     agcgaagcgt ttggggcaag aatttatgaa ggctatggtg ctactgaggc atcgccagtc       960
     atatcgctta attgtccgtt ggcatcagta ccgggtagtg tcggaatgat tttacctttt      1020
     atggatttca aagtagaacc agtagaggga attgtacaag gcgggcgttt aaaattatgc      1080
     ggacccaata tcatgttagg ttatcttgat gaggataaac ctggagtaat tatagaacct      1140
     gaagatggtt ggcatgatac gggagatatc gtcaccgtga atgcagatgg attcattact      1200
     atagcaggtc gcgccaaacg ttttgccaag attgctggtg aaatggtatc tcttacagcg      1260
     gtggaaggaa ttgcagcttc aatttggcct gaattattac atgccgctgt tgtgcaaaaa      1320
     tctccaagaa agggggagca aattttctta tttactgaag cagagtatgc agataaagta      1380
     tcatttataa aaaaggttaa ggagagaggg caatcagaat tgctggttcc tcatatgatt      1440
     tatccggcat gccaaattcc tgtcctgcct tcaggaaaaa ttgattatat aacgcttgaa      1500
     aagcaatttt tagaacagaa agaaaccatg gaaacagtat aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page