(data stored in ACNUC7421 zone)

EMBL: CP000675.PE69

CP000675.PE69        Location/Qualifiers
FT   CDS_pept        complement(68705..69013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54069"
FT                   /protein_id="ABQ54069.1"
FT                   /translation="MGEVRMDLYLKTQRWLYHRGNREVKKRILDEFCKTHGYHRKAAAR
FT                   LLRQLPIPDKKTKKQVKRKLMTRTYYWSCLKRFGLPGIRFVAHCGVNSKGSGTLIGL"
     atgggggaag tacgtatgga tttatattta aaaacacagc gttggcttta tcaccgaggt        60
     aatcgtgagg tgaagaaacg catattggat gaattttgca aaacacatgg ctatcatcgt       120
     aaggcggcag caaggttatt aagacagtta cccatccccg ataaaaaaac taaaaaacag       180
     gtaaaaagaa aacttatgac ccgaacatat tattggagct gcttaaaaag atttggcttg       240
     ccagggatca gatttgtggc acattgtggt gtaaactcca aaggtagtgg cactttaatc       300
     ggattatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page