(data stored in ACNUC7421 zone)

EMBL: CP000675.PE690

CP000675.PE690       Location/Qualifiers
FT   CDS_pept        complement(725480..725863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2701"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56613"
FT                   /protein_id="ABQ56613.1"
FT                   /translation="MRKKNRILLASLFSLGSLNAFAAQDLTVVNTSDDLGYVTIGSYSC
FT                   ELTSSCAIPPDNSIRINSDIVEAACANTPADCEIVFGVDSIKARIATGSFSLNEGIQYI
FT                   AQSRWLNYSAKRLSKTVAEIYKR"
     gtgagaaaaa aaaacaggat acttttggca agtttattct cgctaggcag cctgaatgcc        60
     tttgctgctc aagatctcac ggttgttaat acgtccgatg atctgggata tgtgacaata       120
     ggatcctatt cctgtgaatt gacttccagt tgtgctattc cccctgataa ttcgattcgt       180
     attaactctg atatcgtaga agcagcttgt gcgaataccc ccgctgattg tgaaattgtt       240
     tttggggttg acagtataaa agcaagaatc gcgaccggaa gctttagttt gaatgagggg       300
     atacaataca tcgctcaatc tcgttggctg aattattctg ctaagcgttt atccaaaacc       360
     gtggctgaaa tctataaaag ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page