(data stored in ACNUC7421 zone)

EMBL: CP000675.PE698

CP000675.PE698       Location/Qualifiers
FT   CDS_pept        733786..734121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2693"
FT                   /product="metal-sulfur cluster biosynthetic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2693"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56605"
FT                   /protein_id="ABQ56605.1"
FT                   /translation="MFGFKKKQSNESIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVN
FT                   DEGHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEPPWSQDRMTEAAR
FT                   LELGIFY"
     atgtttggtt ttaagaaaaa acagagtaac gaatcaataa aggaaggcgt tattaccgcg        60
     ttgaggggag tttttgatcc cgaaattccg gtcaatattt atgatctggg cttgatttat       120
     gacattgccg ttaatgacga aggccatgtt catattcaga tgacgctaac gaccccgggg       180
     tgccctgtgg cgcaaacttt tcccggtacg gtggagcagg cagtcaatca ggttgaagga       240
     gtcagtgatt gcactgttga gttggtgtgg gagccgccct ggtctcaaga ccgcatgaca       300
     gaggctgccc gcctggagtt gggaatattt tattga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page