(data stored in ACNUC7421 zone)

EMBL: CP000675.PE70

CP000675.PE70        Location/Qualifiers
FT   CDS_pept        69153..69647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54070"
FT                   /protein_id="ABQ54070.1"
FT                   /translation="MKAFNVPKSMETLFSKAQAYVQDYFQNLKIDPSKGTIDINGERYI
FT                   LVRAASMSIEFFETVKKLYENDASKSEEVVFQLLFDISHSIGKQDAKKFHKQLSLKDPI
FT                   EKLSAGPPHFAFSGWAFVDILPESKPTPDENFYLVYNHSYSFESSAWLKANKKINFLFA
FT                   S"
     atgaaggcat ttaatgtgcc caagtcaatg gagactcttt tttcaaaggc gcaagcttat        60
     gtacaagatt attttcaaaa tttgaaaata gatccgagca aaggaacgat tgatatcaat       120
     ggcgaacgat atattttggt tcgcgcagca tcaatgtcca tcgaattttt tgagacagtt       180
     aaaaaattat atgaaaacga tgcctcaaaa agtgaagagg tggtttttca attattattt       240
     gatatctcac attccatcgg aaaacaagat gcaaaaaaat ttcataagca actcagttta       300
     aaagatccaa ttgaaaaact ttcagcaggt cctcctcatt ttgcattttc tggctgggct       360
     tttgttgata tcttgcccga gtccaaacca acacccgatg aaaatttcta ccttgtttat       420
     aatcatagtt actcatttga atcaagcgca tggcttaagg ccaataaaaa aataaatttc       480
     ctgtttgcat catga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page