(data stored in ACNUC7421 zone)

EMBL: CP000675.PE708

CP000675.PE708       Location/Qualifiers
FT   CDS_pept        complement(742497..743099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2683"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2683"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56595"
FT                   /protein_id="ABQ56595.1"
FT                   /translation="MALEIITIEKKENYHMLKTRAENIQFPLNREDKDLIEAMKKKLYA
FT                   LGGVGLAAPQVNSAKQIIAVYIPEEAQLLRDNAKIFPMHILINPNYEPLPHTRIISDFE
FT                   GCYSVSSKAGKVPRYDEIQLKYYDEEGNVHQQIENGFYARVLQHEIDHLNGVLITDRLT
FT                   PDCVQGTIEEMMTIRRAELPVEKRKLFDQIMAKKLKK"
     atggctttag aaattattac aatagaaaaa aaagaaaact accatatgct aaaaactcgg        60
     gctgaaaata ttcaatttcc cttgaatcga gaagataaag atttaataga agcgatgaaa       120
     aaaaaattat acgcattggg aggggttggt ttggcagcac cacaagtcaa ttccgccaaa       180
     caaattatcg cagtttacat ccctgaagaa gctcagcttt tacgtgataa tgcgaaaatc       240
     tttccaatgc acatcctaat caatccaaat tacgagcccc tgccccacac tcgtattatt       300
     agcgactttg aaggttgtta ttctgtatcc agtaaagcag ggaaagtgcc aagatatgat       360
     gaaattcagc taaagtacta tgatgaagaa gggaatgttc accaacaaat cgaaaatggc       420
     ttttacgccc gtgttttgca acatgaaatt gatcatctga atggcgtatt aatcaccgat       480
     cgtttaactc ccgattgtgt acaagggact attgaagaaa tgatgactat tcgccgtgct       540
     gaattgcctg tagaaaaacg aaaattattt gatcaaatca tggcaaaaaa acttaaaaaa       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page