(data stored in ACNUC7421 zone)

EMBL: CP000675.PE71

CP000675.PE71        Location/Qualifiers
FT   CDS_pept        69739..69900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54071"
FT                   /protein_id="ABQ54071.1"
FT                   /translation="MSADPHHFKYMHNMHEWCSKSVEPYFNFLQNIPINQFPWLISKLK
FT                   KKESSECK"
     atgagcgctg atcctcatca cttcaaatac atgcataata tgcacgaatg gtgctcaaaa        60
     tcggtcgagc cctattttaa ttttctacaa aatataccaa ttaaccaatt tccttggtta       120
     atttcaaaat taaaaaaaaa agaaagtagt gaatgtaagt ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page