(data stored in ACNUC7421 zone)

EMBL: CP000675.PE710

CP000675.PE710       Location/Qualifiers
FT   CDS_pept        744618..745739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2680"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56593"
FT                   /db_xref="GOA:A5IGU3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGU3"
FT                   /protein_id="ABQ56593.1"
FT                   /translation="MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDILELLGRSS
FT                   FPGSFTPEITESMLEIATDVHEEYDQLLKQLFHIRDALVTVGDRLNIGICGGGTHPFQM
FT                   WSDQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHIGCEDGNQALFLLHSLNRYIPHFIA
FT                   LSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPFVLNWDEFSLGYFEKMEHTGIVKSMK
FT                   DFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYMQALCSYLLENKEPLPHEDDYLVY
FT                   NYNRFQACRFGLDGTLVHPKTYEQILLREDILTTLRRLKPYANQLNSTMALEHIYEITH
FT                   KGSDASFLREKYAEHRTLESVVNESLKQFRRSK"
     atgcctttac aaccattcaa aacatctaat ttactgacta tgggggttga gctggaatta        60
     caattaatca gcttaagtaa ttttgacttg actgccgcta gccctgatat attggagctc       120
     ttgggacgat cgtcttttcc cggcagtttt acgccagaaa tcacagagag tatgttagaa       180
     atagcgacag atgtgcatga agaatatgat caactactga aacaactgtt tcatatacgc       240
     gatgccctgg tgacagttgg agaccgatta aatattggta tttgtggcgg gggaacccat       300
     ccatttcaaa tgtggtctga tcagcgaatt tttaataaaa ccaggtttat agaggtgtct       360
     gaattatatg gctatctaac caagcaattt actatttttg ggcaacatat acatattggt       420
     tgtgaggacg gtaatcaagc gcttttttta cttcattctt taaatcgtta tatccctcat       480
     tttattgcat tgtctgcttc atctcccttc gttcagagta aggatacctt gtataactct       540
     gctcgattga attcggtatt tgccttccca ttaagtggaa gggctccctt tgtattaaac       600
     tgggatgaat tctcactcgg ttatttcgaa aaaatggagc ataccggcat agtgaaaagt       660
     atgaaggatt tttattggga tttaagacct aaacctgaat ttgggacaat tgaaatgcgg       720
     gtgtgtgata gtccccttac ggttgagcga gcagccgctt tagcatgtta tatgcaagcg       780
     ctttgcagtt atttattgga aaataaagaa cctctgcctc acgaagatga ttatcttgtg       840
     tacaattaca atcgttttca agcatgccga tttggtctgg atggcactct ggtgcatccc       900
     aaaacatatg agcaaatttt gcttcgagaa gatattttaa caacacttcg ccgattaaag       960
     ccttatgcta atcagctaaa tagtactatg gctttggagc atatttatga aataactcat      1020
     aaagggagtg atgccagctt tttaagagaa aaatatgcag aacatagaac tcttgaaagt      1080
     gtggtcaatg aatcattaaa gcaattcagg cgttctaaat aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page