(data stored in ACNUC7421 zone)

EMBL: CP000675.PE711

CP000675.PE711       Location/Qualifiers
FT   CDS_pept        complement(745804..746205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2679"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56592"
FT                   /protein_id="ABQ56592.1"
FT                   /translation="MINQQIEVFLKSPAFAVVGASSNREKYGNKVLRCYLRNGKKVYPV
FT                   NPHETLIESLPVIHSVNDLPDDVHSISIITPPSITEEVVKEAVKKGIQHIWMQPGAESD
FT                   SAIQYGLDHKLNVISGGPCILVVMGYEEN"
     atgattaatc aacagataga agtatttttg aaatctcctg cttttgccgt agttggcgcc        60
     tcttccaata gggaaaaata cggcaacaaa gtattgcgat gctatcttcg gaatggcaaa       120
     aaagtctatc ctgtaaatcc acatgaaacg ctgattgaaa gcttgcctgt tattcattca       180
     gtaaacgatt tacctgatga tgtacacagt atttctatta tcacccctcc atccattact       240
     gaagaagtcg tcaaggaagc agtcaaaaaa ggaatccaac atatatggat gcagcctgga       300
     gcagagagtg actcggccat tcaatatggc ttggatcaca agcttaatgt catttctggg       360
     ggaccttgta tattggttgt catggggtat gaagagaatt aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page