(data stored in ACNUC7421 zone)

EMBL: CP000675.PE712

CP000675.PE712       Location/Qualifiers
FT   CDS_pept        746350..747207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2678"
FT                   /product="GTP cyclohydrolase I PLUS perhaps regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2678"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56591"
FT                   /db_xref="GOA:A5IGU1"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGU1"
FT                   /protein_id="ABQ56591.1"
FT                   /translation="MNKELESIYQNIANQSELGQTANYDSYYNPKRLYPIPRAPKRQEI
FT                   NLDPNSTTFYGFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLN
FT                   NSTFPDVETVVQTISKDLSYCIGSEVAVNVYPLSDIPNQTIYAAFDGVCLDKLDIECSV
FT                   YHVMPDFLSTSSELVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGKKINHEGLLKYLIS
FT                   FRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIRSTEPCAFDGQNIR
FT                   LIRQ"
     atgaataagg aacttgaaag tatttatcag aatatagcaa atcaatcgga gctggggcaa        60
     actgcaaatt atgacagcta ctataatcct aaaaggctgt atcctatccc cagagcccca       120
     aaacgccagg aaattaattt ggatcccaac tccaccactt tctatggttt tgattgctgg       180
     aatcattatg aggtctcctg gttaaactcc aaaggtaaac ctgttgttgc gatggctgtt       240
     atttcttatg attgtcattc cccgtgtatt attgaatcaa agtcattaaa actctatttt       300
     aactcgttga ataatagtac tttccctgat gtggaaaccg ttgtgcaaac tatcagcaaa       360
     gatttaagtt actgcattgg ttctgaagtg gcggttaatg tgtacccctt gtcggatatc       420
     cctaatcaaa ctatctatgc tgcattcgat ggtgtttgcc ttgataagct tgatattgaa       480
     tgctctgtat atcatgtaat gcctgatttt ctttcgacct cgtctgaatt agttgaagag       540
     gtattgtatt ctgatttact taaatcaaac tgcctggtta ccaaccaacc ggattgggga       600
     agcgttcaaa ttatttataa aggtaaaaag ataaatcatg aagggttgct taaatacctg       660
     atttcattta gaaatcataa tgaatttcat gagcagtgca ttgaacggat atttgcagac       720
     attatgcgat tttgccaacc tgagtcattg actgtttatg gacgatatac aagaagggga       780
     ggtctggata ttaacccaat caggtcaaca gaaccttgtg cttttgatgg gcaaaatatt       840
     cgtttaatac gccaataa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page