(data stored in ACNUC7421 zone)

EMBL: CP000675.PE718

CP000675.PE718       Location/Qualifiers
FT   CDS_pept        complement(752873..754801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2672"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2672"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56585"
FT                   /protein_id="ABQ56585.1"
FT                   /translation="MTRAQTHPHQTTVISNLKIIPLTLGWLLKFALLIIIIAVFTPLSP
FT                   KMPAPGLDASWAVGLNQAVAQGLAFGKDIFFTLGPYSSIYTKFYHPATNFMMVGGSLYL
FT                   ALCYWIAIILLMQGIKWRWSIAFAILLFSMIYARDSLFFSYSLIIGLLIHKEIPGKETS
FT                   LKSNFFTLFALLFTPFGLFPLIKGSLLILSIITILLCSFFLSLYKQRNLVVLCLASPVV
FT                   SILFFWIASGQSVFNLPAYISNTISLASGFTEAMATEGDNKELIFFGITSSCILLSILL
FT                   QKQLSPLSKAFLFCIYFVFLFLSYKTGFTRHFGHAFIAGTSVLLASFLLPYFNSNNKVI
FT                   VPLLALSLYTANYINGHYTKISVRDNFISTYTAAYYGLQNRIQNKNWLKENFSLTMNYL
FT                   KARDDFPRLPGTTDIYSYNQTSLIASGMQWSPRPIFQSYSVFTAKMAEINTNYLLSENK
FT                   PDNIIFKVEPIDNRIPSMEDGMSWPTLINHYQPVRLENDFLFLRKKLVNKPVTSLVPLK
FT                   TEIHTFGEQVKIPDTDKPLFVEIEIQPTLWGRLATTFFKPHQLEANLELKNGTQRQYRL
FT                   ISNMAKSGFLLSPLIENSAEFGLLFSQNNYLAGKKVISFSINSKQVPSSHWQTKYTIHY
FT                   KIFASNN"
     atgactagag cccaaaccca ccctcatcaa acgaccgtta tttcaaacct caaaataatt        60
     ccactcactt tggggtggtt attaaaattt gctttgctca ttattataat cgctgttttt       120
     actccactat cccccaaaat gccagctccc ggtcttgatg cttcttgggc tgtaggactt       180
     aatcaagccg ttgcccaagg tttggccttt ggtaaagaca ttttttttac cttagggcct       240
     tattcttcca tctatacaaa attctaccac cctgctacca attttatgat ggttggggga       300
     agtttgtatt tggctttatg ttactggata gctattattc ttttaatgca aggcattaaa       360
     tggcgttgga gtattgcttt tgcaatactt ctctttagta tgatttatgc tcgggattct       420
     ttgttttttt cctattcatt aatcattggc ctactcattc ataaagaaat tcctggaaaa       480
     gaaacatcct tgaaaagcaa tttcttcact ttatttgctt tgctttttac gccattcggt       540
     ttatttcccc tgatcaaggg ctctctttta atattaagta ttattaccat actcttatgc       600
     tctttctttt tgagcctata taaacagcgt aatcttgttg tgctttgtct ggcatctcca       660
     gtagtttcca tattgttttt ttggatagca tccgggcaat ctgttttcaa tctgccagct       720
     tatatcagta acactatctc gctcgcatca ggttttactg aagccatggc aactgaagga       780
     gacaataaag aactaatatt ttttgggatt acctcttctt gcattctctt atcaatactc       840
     ctgcaaaaac agctctcacc attatccaaa gcatttctat tttgcatcta ttttgttttt       900
     cttttcctct cttataaaac ggggttcaca agacattttg gccatgcctt cattgctggt       960
     acctctgttt tgctagcctc ttttttattg ccgtatttta attccaacaa caaagtgata      1020
     gtcccattat tagctctatc cctttataca gcgaattata tcaacgggca ctataccaaa      1080
     atatctgttc gagataattt catttccacc tataccgccg cttactacgg ccttcaaaac      1140
     agaatccaga ataagaattg gttaaaagaa aatttttcat taacgatgaa ttatttgaaa      1200
     gcccgtgatg atttccccag attaccaggt actaccgata tttattccta caatcaaact      1260
     tcattaatcg cctcgggaat gcaatggtcg ccaaggccaa tctttcagag ttattccgtt      1320
     tttactgcaa aaatggcaga aatcaatacg aattaccttt taagcgagaa caaaccggat      1380
     aacatcattt ttaaagtaga accaattgac aatagaattc cttcaatgga agacgggatg      1440
     agttggccga cactgattaa tcattatcaa ccagtacggt tagaaaatga ttttttattt      1500
     ttaagaaaaa aattagttaa caaacctgtt acatctttag tgccattaaa aacagaaatt      1560
     catacttttg gagaacaagt taaaatacct gataccgata aacctctttt tgtcgaaata      1620
     gaaattcaac caacgctctg ggggaggtta gcgactacat tttttaagcc tcaccagctt      1680
     gaagccaatt tggagttaaa aaatggtacc caaagacaat acaggctcat ttccaatatg      1740
     gcaaaatccg gttttctatt atcgccttta atagaaaaca gcgctgaatt tggattgtta      1800
     tttagccaga ataattacct ggcaggtaaa aaagttattt ctttttccat taactcaaag      1860
     caagtgcctt cctcgcactg gcaaacgaaa tatactattc attataaaat ttttgccagc      1920
     aataattaa                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page