(data stored in ACNUC7421 zone)

EMBL: CP000675.PE719

CP000675.PE719       Location/Qualifiers
FT   CDS_pept        complement(754927..755319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2671"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56584"
FT                   /protein_id="ABQ56584.1"
FT                   /translation="MLTTFLATVIGWYLVIVSLFLLFHNEHAKSAMAEIIAHRGSQLIM
FT                   AIVTLITGLLLVVSHNIWIMGWPVVITLFAWLVLLGGLIRFLCPDTAVRVGQSFVDNPM
FT                   RLKIAAVIFFIIGLFLLFNVYYVYLK"
     atgttaacta catttctagc cacagtgatt ggctggtatt tagtcatagt aagcttattc        60
     ttattattcc ataatgagca tgcaaaatca gctatggcag agattatagc tcatcgcgga       120
     tcgcaattga ttatggctat agtaaccttg attacaggtt tgcttttagt cgtcagtcat       180
     aatatctgga taatgggctg gcctgttgtt attactcttt ttgcatggtt agtcttgctt       240
     ggtggtttaa taagattttt atgccccgat accgcagtta gagtaggcca atcatttgtc       300
     gataatccaa tgagactaaa aatagcagct gtaatattct ttattattgg tttgttcctg       360
     ttatttaatg tctattatgt ttatttgaaa taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page