(data stored in ACNUC7421 zone)

EMBL: CP000675.PE72

CP000675.PE72        Location/Qualifiers
FT   CDS_pept        69902..71443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0072"
FT                   /product="hypothetical signaling protein"
FT                   /note="similar to sll1895"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54072"
FT                   /protein_id="ABQ54072.1"
FT                   /translation="MNKLPKWALAEKKEFKREKIQSLLIVPMEKENSLVGFMGFDIVTH
FT                   KKQWLAEDIFMLSTVADIVIQSILKSYTIIEHESIVRYFDPLTRLPNKELFVNYLQAVL
FT                   SNIEQQENCFSFLILLNIDEFHIINDAYGTPFGDQLLFIIAEKLLHILPYKAKLCRLEA
FT                   DRFLILLQGNKAEILKIADEILSMFNHVFKLNNHQVYLQARIGVTKIDNHSDNPEKLIQ
FT                   RASLAMRKARLDNIKIAIFESNTEKSVNLKLNIQAELYQAITENQLVLHYQPQFCAKTK
FT                   QIVALEALLRWMHPKKGLLYPSEFLDVLLCSDLLLPAGEWVLKTVCAQNVAWIKQGLRP
FT                   VSIAVNISEPQFRQPNFVPMLKKILTKTHMDPCLLKLEVTEQVMIDHLDETARKLHEIE
FT                   AHNIQIILDDFGTGYASLSYLHQLPISKLKIDKSFIKNMLTNKNAAMITKTIILLAKGL
FT                   GIKSLAEGVETKEQFDILKQLGCDEIQGYYFSEPLPVEKIALFLQDGSTPNKGAF"
     atgaacaagt tgcccaaatg ggcacttgct gaaaagaaag agtttaagcg ggagaagatt        60
     caatcgttat tgattgttcc catggaaaaa gaaaattctt tggttggatt catggggttt       120
     gatatagtca ctcataaaaa acagtggctt gcagaagata tttttatgtt gagtacagtg       180
     gcagacattg tcattcaatc catattgaaa tcctacacca tcatagagca tgaatcgatt       240
     gttcgatatt ttgacccact gacaagactt ccgaacaaag aattgtttgt caactatctt       300
     caagctgtat tatctaacat tgagcaacag gaaaattgtt tttccttttt aattttgttg       360
     aatattgatg aattccatat tattaatgat gcttatggaa cgccttttgg tgatcaactg       420
     ttatttatta ttgcagaaaa gttattgcat atactgcctt acaaggcgaa attatgccgc       480
     cttgaagctg atcgttttct cattttgctg caggggaata aagcagaaat cttaaagatt       540
     gccgatgaga ttttatccat gtttaatcat gtttttaagc taaataacca ccaagtttat       600
     ttgcaagcca gaattggggt tactaagata gacaatcatt ctgataatcc agaaaaatta       660
     atacaacgag ctagcctcgc catgaggaaa gcaaggttgg ataatataaa aatcgcaatt       720
     tttgaatcta acactgaaaa atccgtaaat ttaaaattaa atattcaagc cgaattgtac       780
     caagcgatca ctgagaatca gttagtgtta cattatcaac cgcaattttg cgcaaaaaca       840
     aagcagattg tggctttgga agctctacta cgttggatgc accctaaaaa aggactttta       900
     taccctagtg aatttctcga tgtgctgctg tgttctgatt tgcttttacc cgcgggtgag       960
     tgggtgctaa aaacagtctg tgctcaaaac gtagcatgga taaaacaagg acttagaccg      1020
     gttagtatcg cagtcaatat atccgagcct caatttaggc aacctaattt tgtccccatg      1080
     ctgaaaaaaa tactaacaaa gacccatatg gatccctgct tattgaaatt agaagtaaca      1140
     gagcaggtga tgattgatca cttggatgaa acggctagga aattacatga gatagaagct      1200
     cataatatac aaattatatt ggatgacttt ggtactggat atgctagttt aagttattta      1260
     catcagttac ctattagtaa attaaagatt gataagtcat ttataaaaaa catgctaacc      1320
     aacaaaaacg ccgccatgat tacgaaaact attattttat tagcaaaggg gttaggcatc      1380
     aaatctcttg ctgagggcgt tgaaaccaaa gagcaatttg atatccttaa gcaattaggt      1440
     tgtgatgaga tacaagggta ttattttagc gaaccactgc cggtggagaa aattgcttta      1500
     ttcttgcaag atggctctac cccaaataag ggggcatttt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page