(data stored in ACNUC7421 zone)

EMBL: CP000675.PE720

CP000675.PE720       Location/Qualifiers
FT   CDS_pept        755456..755833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2670"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2670"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56583"
FT                   /protein_id="ABQ56583.1"
FT                   /translation="MMKKINLFKLLMIFVLGTSALQAAGLSTQRIEQLSNARVTVWKTI
FT                   IYPSSKQVLPMHRHDNDRVLVALTDGTLKITNNKGKVHYLKLKKGKSYYLTKDVPNELH
FT                   NDENVTNHSIQVMVIQLNDKA"
     atgatgaaaa aaattaattt attcaaattg cttatgatct ttgttctggg tacaagtgca        60
     cttcaggctg caggattatc aacccaacgt attgaacaat tatctaatgc cagggtaacc       120
     gtgtggaaaa caattatcta tccctcttca aaacaagttt tgcccatgca caggcatgat       180
     aacgatcgag ttttggtcgc attgacggat gggacattga aaattacaaa caacaaaggg       240
     aaagtacact atttaaaatt aaagaaaggc aagtcgtatt atcttaccaa agacgttcct       300
     aacgaattac ataacgatga aaacgtaact aaccattcaa ttcaggtgat ggtaattcaa       360
     ctcaatgata aagcatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page