(data stored in ACNUC7421 zone)

EMBL: CP000675.PE724

CP000675.PE724       Location/Qualifiers
FT   CDS_pept        complement(760143..763652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2666"
FT                   /product="type IV fimbrial biogenesis PilY1-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2666"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56579"
FT                   /protein_id="ABQ56579.1"
FT                   /translation="MDALTFWNFTRKGSQKAIKVLPRTLMAILLSASVSLYAVPLAIPQ
FT                   IPLIIASPVHPQVLILLSNSQSMDGNLSGAIMTGSGSLSTGLSSLYNSSSPVNYTVPAG
FT                   FTPPVQGPDANGLAPYTVVQGGNKVDNSASRLNVAKAGIKAIIENYMPTTDFALGTYST
FT                   SNISSYNTWVYYMSPPGSDFVFTNTPVAGNRYVTNPCYNYGSASSTVSSNCSSIGSLYG
FT                   TTLVSSSQYLQIGDSSDDPDINDVLYAGSGFPGIFVSYNGPTPSSPFPPNYTISNYNQG
FT                   NIRISYANTRPSIGNFSSSPTNAGFVPFSQQVMYVQRGFGYYSNQSYATGNMLVNMQTA
FT                   GTNPTTTSVNNAINAFLPHLKPETNSTATTEIKAAAVQSPLAGLLTRSRSFMKTVGTTS
FT                   GNCPQKQYIILISDGLPTQDLQSRYWPPLGSAAATGYGVTATFNADGSLNSTNSQALSD
FT                   AINEIKALKNDGVLTFIIGMGAGVDPAVNPEAAATLRAMAVAGGTENYYPATSPEALVS
FT                   SLNSILSNIQNGSFSTSAAAISSTRIDSSTVEYQANFITRDTPYQDWTGNLTAIELDEN
FT                   TGQPTNIIQWSAQSTLDSLVSGTGWSTNRKIATWDPIAADGVPFRWANINATQQAQLQP
FT                   SDLLGENRLEYLRGNAALEKRNGGTFRDRSHALGDIIDSQVIYVGPPSAPYLTASYISF
FT                   AKANANRQPMLYVGANDGMLHAFNATTGEEFFAFIPNAVFNNLHQLTSPLYNQNHLFFV
FT                   NGSPESADVQFSDGSWHTILVGGENAGGKSIFALDITNPTNLSSEPGVANAVLWEFTDT
FT                   DLGLTYSKPQIGQIRSGSPSSLNFAVFFGNGYNNTNNKSVFYAVDPQTGTLLRKIDLCA
FT                   AVPSACNVNLPQGLSTVALGQKDGLQADPVTVVYAGDLQGNLWAIDVSSADPASWSARV
FT                   LFQARDSAGTPQPITTPPLVTLNPNYPRNPGLFVVFGTGQLLTTSDLVTTQRQTIYGVW
FT                   DKPLSSVPYVRANLQQQTLTLVNSATSGLSTNIITATAATINWSNKVGWFADLPIAGQR
FT                   LITTPELINGAFIATINTPPLNSCGFGFTSMLLELNFLNGGAFQYARFDISGDGGFDIA
FT                   DQYNGAYPVGIGLSNSYANSPTVLGPNKDNNLVILITQSDGTQTTVIAPNITPRKIGWW
FT                   QIQ"
     atggacgctt taacattttg gaatttcacc agaaagggaa gtcagaaagc aataaaagtt        60
     ctacctcgaa cacttatggc tattctgttg tctgcttccg tttctcttta tgccgttcct       120
     ttagcaattc cgcaaatccc actaatcatt gccagccccg ttcatcctca agtgttgatt       180
     ctcctcagta actcccaatc gatggatggt aatttgagtg gagcaatcat gacaggatcc       240
     ggctctctgt caactggttt aagctccctt tacaattcca gctcaccagt gaattatacc       300
     gtaccggctg gatttactcc gccagtgcaa ggccccgatg ccaacggcct ggctccttat       360
     actgtagttc agggcgggaa taaagtagat aacagcgcaa gccgtctcaa tgtggccaaa       420
     gctggaatca aagcgattat tgaaaattac atgcctacca ccgactttgc attgggcact       480
     tacagtacaa gcaacatcag ttcttataac acttgggttt attacatgtc gccacccggc       540
     agtgactttg tgttcaccaa caccccggta gctggaaatc gatacgttac caacccttgt       600
     tataattatg gttccgcatc gtctacagtt tcaagcaact gctcatccat tggaagctta       660
     tatggtacga ctttggtttc ttcaagccag tatctgcaaa ttggtgattc cagcgatgat       720
     ccggatatta atgatgtact ctacgctgga agcgggtttc ccgggatttt tgtcagttat       780
     aatgggccga caccatccag tccttttccc cccaattata cgatctccaa ttataaccag       840
     ggcaacatca gaatttccta tgcgaacaca agaccttcta ttggcaattt ttcctcttct       900
     cccactaacg ccggttttgt acctttttca cagcaggtaa tgtatgtgca aaggggattt       960
     ggatattaca gcaaccaatc ctatgccact ggcaatatgc tggtgaacat gcaaacagcg      1020
     ggtaccaatc caacgactac cagtgtcaac aatgccatta atgccttttt acctcatttg      1080
     aaaccggaaa ccaactccac tgcgaccact gaaataaaag cagctgcagt acaatccccc      1140
     ctcgccggac tactgacccg ctcacgaagt ttcatgaaaa ctgtgggtac aaccagtggc      1200
     aattgtccgc aaaaacaata catcatatta atttctgatg gattgccaac ccaggacctc      1260
     cagtcaaggt attggccacc actaggcagc gcggctgcca ccggctatgg ggtcaccgca      1320
     acatttaatg ccgatggctc actgaacagc acgaacagtc aggccctgtc cgatgcaata      1380
     aacgaaataa aagctttaaa aaatgacggt gttttaactt ttataatagg gatgggagca      1440
     ggtgtggatc ctgctgtaaa tcctgaggca gcagcaactc tcagggccat ggccgttgca      1500
     ggaggcactg aaaactatta tccggcaacg agtcctgagg ctctggtcag cagtttaaat      1560
     tccattctat cgaatatcca aaatggctct ttttcaacct ctgcagcagc cattagctca      1620
     actcgtatcg acagcagcac cgtggaatat caagccaact ttattacaag agatacacct      1680
     tatcaggatt ggactggtaa tttgacagct attgaactgg atgagaatac tggccaacca      1740
     acaaatatta tacaatggtc agctcaatcg acacttgatt ccctggtatc aggaaccgga      1800
     tggtcaacta accgaaagat agcgacttgg gatcctatag ccgcagacgg agtaccgttt      1860
     cgctgggcga atattaatgc cacccaacaa gcacaactgc aaccaagtga tttgttagga      1920
     gaaaaccgat tagaatacct gcgtggcaat gccgccctgg aaaaaagaaa cgggggaaca      1980
     ttccgtgatc gctcgcatgc tttgggagat attatcgata gccaggtaat ttatgttggt      2040
     cccccaagtg ccccatattt aaccgccagt tacatcagct ttgcaaaagc caatgccaat      2100
     cgacagccga tgttatacgt tggggcaaat gacggaatgc ttcacgcctt taatgcaacc      2160
     actggagaag agttttttgc atttattccc aatgccgtgt ttaataatct ccaccaactc      2220
     acttctcctc tgtacaacca aaatcattta ttcttcgtca acggctctcc ggaaagcgct      2280
     gatgtacaat tttccgatgg ttcctggcat accattctgg tgggaggtga aaatgcaggt      2340
     ggtaaaagca tctttgccct ggacattaca aatccgacaa accttagttc tgaaccagga      2400
     gtggccaatg ctgtgctctg ggaatttaca gatactgact tagggttaac ttatagcaaa      2460
     cctcaaatag gtcaaatcag atccggaagt ccatcttcat taaattttgc cgtctttttt      2520
     ggcaatggat acaacaatac taacaacaaa tcggtatttt atgccgtcga ccctcaaaca      2580
     ggaacactac taagaaaaat agatctttgt gctgctgtcc cttcagcctg caatgtcaat      2640
     ttaccccagg gattatcgac agtcgctttg ggacaaaaag acggattgca agccgatcct      2700
     gttactgtag tgtatgccgg tgatttacaa ggcaatctat gggcaatcga tgtttcctcg      2760
     gctgatcctg ccagttggag tgcgcgtgta ttattccagg caagagactc tgcgggtaca      2820
     ccgcagccta tcactactcc tcctttagtg acattaaatc ctaattatcc tcgcaatcca      2880
     ggactttttg ttgtgtttgg caccggacaa cttctgacca catccgattt ggtcactacc      2940
     caaaggcaaa ccatttatgg agtatgggac aagccgcttt catccgtacc ttatgtacgt      3000
     gccaatctcc agcaacaaac gttgaccttg gttaactcag ctacatcagg tttatccaca      3060
     aacattatca ctgccactgc tgctaccatc aattggagta acaaagtggg atggtttgcc      3120
     gatttgccta tagcgggaca aagactcatt actacacctg aactaattaa cggggcattt      3180
     attgcaacaa taaatacccc acctcttaat tcgtgcggct ttggattcac atccatgctt      3240
     ctggagctta atttcttaaa tggcggggct ttccaatatg cgcgatttga tatttccgga      3300
     gatggcggct ttgatatagc cgatcagtat aatggggcct acccagttgg aattggcttg      3360
     tccaacagtt atgctaactc accaactgtt ctggggccta acaaggataa caatctggtc      3420
     attctgatca cacaatcgga tggaacacaa accactgtta ttgcacctaa cattacgcca      3480
     agaaaaatag gctggtggca aattcaatag                                       3510
//

If you have problems or comments...

PBIL Back to PBIL home page