(data stored in ACNUC7421 zone)

EMBL: CP000675.PE725

CP000675.PE725       Location/Qualifiers
FT   CDS_pept        complement(763665..764177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2665"
FT                   /product="Tfp pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2665"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56578"
FT                   /protein_id="ABQ56578.1"
FT                   /translation="MNVSSTNQYSKQRGYVLITSLVLMSMLTVLALTQISQNTSQTRIA
FT                   TNATDSEISFEKTEGAINEAINLIINGTYNPQSFLASNNGMYLFDQSATTPLWKTINWS
FT                   SGSAVINSFQGNTGAQASYYLEKLPSVIMPGQSMKKPSNVYRITARSSGASGDTSVLIQ
FT                   STIQIQQ"
     atgaacgtat cctccacaaa tcaatattca aaacaacggg gttatgtcct gataacttct        60
     cttgtactta tgtcaatgct taccgttttg gccctgaccc agatatcaca aaacacgtct       120
     caaaccagga ttgcaactaa cgcaaccgat tcggaaatca gttttgaaaa aactgaaggt       180
     gccattaatg aagccattaa tctgatcata aatggtactt ataatccaca aagttttctt       240
     gcttctaata atggaatgta tttatttgat caaagtgcta ctactccact ttggaaaacg       300
     attaactggt caagtggttc ggcagtcatt aacagctttc aaggcaatac aggggcacaa       360
     gccagctatt accttgaaaa actgccgtcc gtgattatgc caggccagag tatgaaaaag       420
     ccaagtaatg tctacagaat aactgctcgg tcatcaggag caagcgggga tacttccgta       480
     cttatacaaa gtacaattca aattcaacag tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page