(data stored in ACNUC7421 zone)

EMBL: CP000675.PE726

CP000675.PE726       Location/Qualifiers
FT   CDS_pept        complement(764174..765241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2664"
FT                   /product="type IV fimbrial biogenesis PilW related protein,
FT                   transmembrane)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2664"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56577"
FT                   /protein_id="ABQ56577.1"
FT                   /translation="MNINYRLQQGFSLVELMIATLVGLILTYSILQIYLAQTQLYKASN
FT                   SQDLIQSTENAISNLLIPVIRSAGFAGCGSIITAVSSLNAGGPRPLGILNTTPTILMGY
FT                   NGSGASFTITQSNPANSSNASHWSPALDSTLVGNAQQGSDVLVVLGSTSDSYPTGITTI
FT                   DPGSNTFVVQGTSGMSLTSGMFGAVSDCGKTVIFQITGVAGTTITHDAGAGVLQNASSA
FT                   FPVNFQTGSQFIPIQQTAFFVGQGQGGQSALMRASLVGNNWTIQPLVPGVEIMKVQYGI
FT                   GNNGVITRYVSANAVTDWAQVYAIRLGFLIAGQLGSGSLTTRQYNVLDTQITVPADNRL
FT                   RHVFELTINLRNSIS"
     atgaatatta actacagact acaacaagga ttttcattag tcgagttaat gatagccacc        60
     ttggttggac tgatactcac ttattcaatt ttacaaatat acctggctca aacccaactt       120
     tacaaagcat caaactctca ggatcttatt caaagtactg aaaatgccat atccaattta       180
     ctcataccag tgatcagatc ggctggattt gccggctgcg gatccattat caccgcagtt       240
     tccagtctaa atgctggtgg cccaaggcct ttgggaatat tgaatacaac gccaacaatc       300
     cttatgggtt acaatggcag cggagcgagc ttcacaataa cccaaagcaa tcctgcaaat       360
     agcagcaatg ccagtcattg gtcacccgca ttagattcca cccttgttgg caatgctcaa       420
     caaggtagtg atgtgttggt agtattaggc tctacctctg acagctatcc aacaggaata       480
     accacgattg atcccggcag caataccttt gtagttcaag gcactagcgg gatgtccctt       540
     acctctggaa tgtttggagc ggtctctgat tgtggtaaaa ccgtaatatt tcaaattact       600
     ggagtagcag gaacaacgat tactcatgat gcaggcgctg gagtgctaca aaatgcaagc       660
     agtgccttcc ctgtcaattt tcaaaccggc tcccaattca ttcccatcca acaaactgca       720
     ttttttgtgg gtcaaggtca aggagggcaa agcgcattaa tgcgggcctc tctcgttggc       780
     aacaactgga caatacagcc attagttcct ggggtggaaa taatgaaagt ccagtatggt       840
     attggcaata atggcgtcat tactcgatat gtctctgcta atgcagtaac tgattgggca       900
     caggtttatg ccattcgttt gggatttttg atagcaggtc aactcggctc aggaagcttg       960
     acaaccagac aatacaacgt tttggatacg caaatcaccg tacctgcgga taaccgctta      1020
     aggcatgtat ttgaattgac catcaacttg aggaactcaa tatcatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page