(data stored in ACNUC7421 zone)

EMBL: CP000675.PE727

CP000675.PE727       Location/Qualifiers
FT   CDS_pept        complement(765238..765777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2663"
FT                   /product="type IV fimbrial biogenesis protein PilV"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2663"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56576"
FT                   /protein_id="ABQ56576.1"
FT                   /translation="MINRMDTLAKDKGMTLLEVLISVVILAVGMLGIASMLIVSNKANN
FT                   SSYAKLQAVQAVYDIFDRIRANSDAASNGSYNVSNIGSNGYPTSVSAPSVLCNASVCNP
FT                   NQLAQYDTWYWLTRVVSQLPNGSGSITSALSGVAGNTVITVTVQWDDSKAQNELGASSA
FT                   SSGTANFVQFRVQSQI"
     atgattaacc gaatggatac attagcaaaa gacaagggaa tgactttgct ggaagtgttg        60
     atatctgtag tcatattagc cgttggcatg ctagggatcg ccagtatgtt gatagtcagt       120
     aataaagcga acaattccag ttatgcaaaa ctgcaagcag tacaagcagt ctatgatatt       180
     tttgacagaa ttcgagcgaa ttcggatgca gcatctaatg ggagttataa tgtcagtaat       240
     atcggcagta atgggtaccc tacgtccgta agtgctcctt cagtattatg caatgcatcg       300
     gtatgcaatc caaatcaact ggcacaatat gacacctggt attggctcac cagagtggtg       360
     tcgcaattgc caaatggaag cggttcaata acttctgctc tttcaggtgt ggcaggaaat       420
     accgtgatta ccgtgactgt acaatgggat gatagtaaag cacaaaatga gttaggggca       480
     agcagcgctt cttcaggaac tgccaatttc gttcaattca gagtacagag tcagatatga       540
//

If you have problems or comments...

PBIL Back to PBIL home page