(data stored in ACNUC7421 zone)

EMBL: CP000675.PE730

CP000675.PE730       Location/Qualifiers
FT   CDS_pept        complement(767756..769093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2660"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56573"
FT                   /protein_id="ABQ56573.1"
FT                   /translation="MTFVLKEFDTLKSHFNDTVKIILQREKKDKIEDLPNPRKEELQFL
FT                   TAVLNQLEAKIDELKPRSLASYVHVFYGAMLLVCKDVENNLRVMEKKENSLLFTRLMDG
FT                   MGISDENIPTSEQNIMFYRGLNKFLNFIYESNDSRKGLKKEHFLQVLSLKKIYSLAKLS
FT                   YEQEEAAENNALAKLTADGKTKANANSFHVEKPIDSSIVEQFKSWDEMKGALHQLILDE
FT                   LSDKNVAKISALSQARSAQLKFLQTMAEQLDKIPNQSLEPSEKMAILAGAMYIVRGQIA
FT                   QEYGKDPLSNDKISATVIHTGLSTILHANADCCEDKEVLIAAANKFIRHMVIERPEQSN
FT                   KKITKESIRENNMFSDIAGFQLISVLTLIQNMIKTCRTDAIEACVTKRKEELEALNPKK
FT                   EGYSIASSVTGYVGSWFKKAPSISEEDEEDDLKDQNTAEETSKPTV"
     atgacgtttg ttttaaagga atttgataca ctaaaaagtc attttaacga caccgttaaa        60
     atcatccttc aacgcgaaaa aaaggacaaa attgaagacc ttcccaaccc cagaaaagaa       120
     gaacttcaat ttctgaccgc tgttctcaat caattggaag caaaaatcga tgaactgaaa       180
     ccacgttcat tggccagcta tgtccatgta ttttatggtg ctatgctgct tgtctgtaaa       240
     gacgttgaaa ataatctgcg ggtgatggaa aagaaagaaa acagcttact gtttactcgc       300
     ttaatggatg gtatgggtat ttctgatgaa aatataccaa catccgagca gaacatcatg       360
     ttttacagag gattaaacaa attcttaaat ttcatttatg aaagcaatga ttctcgtaaa       420
     ggcttaaaaa aggagcattt cctgcaagtc ctttcgttaa aaaagatata ctctttagcc       480
     aaattaagtt atgagcagga agaggcagct gaaaataatg ctttggcaaa attaactgct       540
     gatggaaaaa ccaaagccaa tgcgaacagc ttccatgtgg aaaaaccaat cgattcatcc       600
     attgttgagc aattcaaatc ctgggatgaa atgaaaggcg ctcttcatca attaattctc       660
     gatgaacttt ctgataagaa cgttgctaaa atttcagctt taagccaagc ccgctcagca       720
     caactgaaat ttttacaaac gatggcagaa cagctagaca agatccctaa ccaatctctt       780
     gagccgtctg agaaaatggc cattcttgct ggagcaatgt atatcgttcg tggccaaata       840
     gcccaggagt atggaaaaga tccattaagc aacgataaaa tcagcgctac tgtgattcat       900
     actggtttaa gcacgatact tcatgccaat gctgattgct gtgaagacaa ggaagtactg       960
     attgctgctg cgaataaatt tattcgtcat atggttattg aacgccctga acaatcaaat      1020
     aaaaaaatca ctaaggaatc cattcgagaa aacaacatgt tttccgacat cgccggcttc      1080
     caattgatct ctgtcttgac gttaatacaa aacatgatca aaacatgtcg tactgatgcc      1140
     attgaagctt gtgtcaccaa gcgtaaggaa gaactcgaag cattaaaccc caaaaaagag      1200
     ggttattcca ttgcgagttc agtcactgga tatgtaggca gctggtttaa aaaagcacca      1260
     agcatatctg aagaagacga agaggatgac ttaaaagatc aaaacacagc agaagagacc      1320
     agtaaaccga ccgtataa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page