(data stored in ACNUC7421 zone)

EMBL: CP000675.PE738

CP000675.PE738       Location/Qualifiers
FT   CDS_pept        777751..779325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2651"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56565"
FT                   /protein_id="ABQ56565.1"
FT                   /translation="MKTQRIIHPNIDIRKFPEVNANFSMTDISMGDLHANALLFLNILV
FT                   RQGIIAISPENYAKFAEIYILPELQADYWGTEAPVFSAGNKQERLEEIKKQYNALIAQI
FT                   KIINTKKLIRLIGDELVDRGVIDYFILKLLQALHDQGADFEILLSNHGIEFVEACELFK
FT                   ENGNKLVAKRLGNIQHGNSFHALQEAIAAGSISNEEVLNIYHQVYKKHLKIISYALDPD
FT                   ANEIKVFSHAGIGLNHIRGLTRKFKVPYSEESAVDLARTIDAINKKFAEKASAGEIHTL
FT                   YTHDMMYRGYAGEYLNSTDEVVAATVWGREYGDLIRTSKKFKVTFIHGHDSYDPEKVEH
FT                   VTLNNQLGQFQNNVGDLYLYATNGMRAVPTQCLNPDKKVQSLREKNRPDKPNDYVVKVH
FT                   HTKPSFFKTAHPKMTFPDSYKRIWDSTPGHSNITKIKALLKDYTKEDSILGSFWGLIFT
FT                   LHWGRHHVKSVHQIAQTQYTSVEAILSDLKALKPREGGSLDKRIKFIESQIITQKVNNP
FT                   ELQFKLK"
     atgaaaactc agcgaattat ccatcccaat attgatatta gaaagtttcc tgaagtaaat        60
     gcaaattttt ccatgaccga tattagcatg ggagatttgc atgctaatgc tttgcttttc       120
     ctcaatattc ttgttcgcca gggaataatt gctatttctc ccgaaaatta tgccaaattt       180
     gctgaaattt atattttgcc agagcttcag gcagattact gggggaccga agcacctgtt       240
     tttagcgctg gaaataaaca ggagcgtttg gaggaaatca agaaacaata caatgcatta       300
     atagcgcaaa tcaaaattat taatactaaa aaattgattc gcttgatagg tgatgaatta       360
     gtagatcgcg gtgttattga ctatttcatt ttaaaattat tacaagcttt gcacgatcaa       420
     ggtgctgatt ttgaaatatt actttcaaat catgggattg agtttgtcga agcctgtgaa       480
     ctattcaagg aaaatggaaa caaattagta gcaaaaagac taggaaatat tcagcatggt       540
     aattcatttc atgctttgca agaagcaata gcagctggtt cgatttcaaa tgaagaagta       600
     ttaaatattt accatcaagt ttacaaaaaa cacttgaaaa ttatttctta cgcattggat       660
     ccagatgcaa atgaaattaa agtgtttagt catgctggta ttggtttaaa tcatattcga       720
     ggacttacca gaaaatttaa agtaccttat tcagaggagt cggctgttga tttggctaga       780
     acaattgatg caattaacaa aaaattcgca gaaaaagcat ctgcgggaga aattcacacg       840
     ctttataccc atgacatgat gtatagaggt tatgcaggtg aatatttgaa ttcaacagac       900
     gaagtggttg ccgcaaccgt atggggacgt gaatatgggg atttgattcg aacgtctaaa       960
     aaatttaaag tcacctttat tcatggccac gatagttacg atcctgaaaa ggtagaacat      1020
     gtcactttaa ataatcaact agggcaattc caaaataatg taggtgattt atatctgtat      1080
     gccaccaatg gcatgagggc ggttccaaca caatgtttga atccagataa aaaagttcag      1140
     agcctaaggg aaaaaaatcg accagataaa cccaatgatt atgttgtaaa agtccatcat      1200
     acaaaaccat cattttttaa aacagctcat cccaagatga cattcccgga cagctacaaa      1260
     cgaatatggg atagcacacc aggacattcc aatataacca aaattaaggc attacttaaa      1320
     gattatacca aggaagacag tattttgggt tctttctggg gattaatatt tacattgcac      1380
     tgggggagac atcacgtcaa atccgtgcat cagattgcgc aaacccaata tacatcagta      1440
     gaagctattc tttcggattt gaaagcactg aagccaagag aaggcggttc actggataaa      1500
     cgcattaagt ttattgagtc acaaattata actcagaagg tgaataatcc agaattacaa      1560
     ttcaaattga aatag                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page