(data stored in ACNUC7421 zone)

EMBL: CP000675.PE740

CP000675.PE740       Location/Qualifiers
FT   CDS_pept        781146..800015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2649"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56563"
FT                   /protein_id="ABQ56563.1"
FT                   /translation="MLAESVIGIVRAVNGLLEKVNVQGQASLVKSGARLEEGDVLTLLS
FT                   GEAYIQFINGFPEALALEKPVKLDGVSPTLQYGAEDLKEQMVQEAIAKGIDPSVILDVL
FT                   GSAAAGAEAVGSGGDAFIMDPLFGFGHVTAGYPTGPISFAYEADTQQLFWFVPEETGAI
FT                   AESELTQEPESIPQIPQFTTNQAVLTVFEDALPSGIPDSAGQARIASSSLSTLLTSSPD
FT                   VVASFAFNTNLSVLPTLKSGGIDLDYNLSSDKRTLTASIPGGAAVMQFELTADGQLTQT
FT                   LMDSIDHPTADSDDSEWMRLDLSPLIDVTFTRTSDGSVLESRTLPANAVVAGIQDDVPI
FT                   ARAQLTNNEILLDETIGMKAGDADAANDDFNPTTTVDPFNNTYGIPIGLVQNANLLDTS
FT                   TSEMGGDYKNATMTHLLKITDAVSGLQTTDGTPINLFLESNGDISGRAGDIGAPAVFAI
FT                   RMNPNTGAITVAQYGSIKQFDTNSHDEAVDLTGRISAVVRVTDGDGDVSNAEIPIGQRI
FT                   VFEDDGPIAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGFAQSSGA
FT                   VVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGDAVF
FT                   AIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAIGIG
FT                   DAIVFEDDGPVAQIAATGVKVTHDETAGVNAGSDDVASPLALFAGVSQKSTDMAGFAQS
FT                   SGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGD
FT                   AVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAI
FT                   GIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGF
FT                   AQSSGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDA
FT                   GGDAVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVAT
FT                   QAIGIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDM
FT                   AGFAQSSGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVG
FT                   RDAGGDAVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGD
FT                   VATQAIGIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLSVFVGVVNKS
FT                   TDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGL
FT                   VVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDG
FT                   DGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVV
FT                   NKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLE
FT                   SGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTV
FT                   TDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAGSNDVAGPLSVFA
FT                   GVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITL
FT                   TLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAV
FT                   VTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVASPLS
FT                   VFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDA
FT                   ITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKI
FT                   NAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAG
FT                   PLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTD
FT                   GDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLG
FT                   GKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSND
FT                   VAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQ
FT                   TTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAV
FT                   NLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAG
FT                   SNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAAS
FT                   GLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYD
FT                   EAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGL
FT                   DAGSNDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIAN
FT                   AASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGS
FT                   SYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIHDET
FT                   TGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLA
FT                   IANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPT
FT                   GGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIH
FT                   DETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKF
FT                   SLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIK
FT                   HPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAK
FT                   VIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGAT
FT                   IKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYE
FT                   SIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAAT
FT                   GAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNE
FT                   GATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVA
FT                   QYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQI
FT                   AATGTKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQ
FT                   DNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVL
FT                   SVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPV
FT                   AQIAATGTKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSV
FT                   TGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADT
FT                   GVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDD
FT                   GPVAQIAATGAKVIHDETTGLDAGSNDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSA
FT                   GSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISID
FT                   ADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVF
FT                   EDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVV
FT                   SSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAI
FT                   SIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDA
FT                   IVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSG
FT                   AVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAV
FT                   LAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGI
FT                   GDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQ
FT                   SSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASG
FT                   KAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQA
FT                   IGIGDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAG
FT                   FAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRD
FT                   ASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVA
FT                   TQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTD
FT                   MAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVV
FT                   GRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDG
FT                   DVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNK
FT                   STDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESG
FT                   LVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTD
FT                   GDGDVATQAIGIGDKVVFEDDGPVASNITRSGLANEGADTNLMLILDTSGSMAGSGIQT
FT                   LINSTLELLERYEALGNVKVRIVTFNTSATAIGSVWMTVDAAKNALLGLTAGGNTNFDA
FT                   ALITAMNAFNSGTVGGADGRIGGAQNVSYFISDGNPTVNQDWPSIPGTLAQNGIQPSEQ
FT                   AAWEAFLQDTNGASAGGEKIRSYALGMGTGITVSNLEPIGFNGVNGTDIPAVVVTDISQ
FT                   LDSVLASTITASPISGTLISDPNPGVNFGADGGHVQSVTVNGITYTVNANLSSLSTSGS
FT                   ATQGSNTHSYDNSTHVLTVTISTGESLTIDMDNGSYTFTPPANITSSINRIINYVLVDG
FT                   DGDTAAATITFNIDISGFNDPLVVRDDLVLTNQPAVSGQDVISIPTWALLANDTGGSGV
FT                   SSVSSVTQPVAEGTVVLNAGSVAFTEESNSAADGTYNGSTSDPFRYTNTTGSQSATAKV
FT                   DLDRTQAGENRLDGTYRSEILLGRDTSNDTIIGNDGNDILIGLGGNDTLSGGNGDDILA
FT                   GGAGNDTLDGGAGNDTATYIDATAGVTVSLNTSSAQNTVGAGTDTLTNIENLTGSKFND
FT                   TLTGNNSANTIKGLEGNDTISGLGGNDTLDGGSGDDVIIGGLGDDILTGGSGADQFVLV
FT                   KGQGGASAGAAPIDTITDFEVNIDKIVINGNNITGVSVSTPVSNTYTITVNYSDAATEH
FT                   FKVTLSNGAVLNDSGKTHLNGVVISGGTATIDGTIVGAVLYLDLNANNQEDEGERLGIT
FT                   NQYGHVEWVVDLSKFDVNGDGQYVIGEARAVQTGGFDIDTGLSYEINLYGPVGSAVISP
FT                   LTSLLQAQLEAGMDYETANAALVARLGLPEGTQIISFNPITGSGEVLAQNAGVMTAAIQ
FT                   FAEIAAIHYSTDEGHVSFAVFEAISKALLELPEGVVADFGDEGFLQSISNYLGLDALVT
FT                   SDMIDYMATSQKALEASILTLAPGEDALTAISKIQHVTQGIYAQAIEMALIGYLPLDAL
FT                   KNMSAVLKAYADGDITDEQLNSFEDKLSAVIVNWEDNNVTDTSHQATLQTERTVDDSSV
FT                   KSEVNHEMAQEVNAVINDFMDEHNISLYYYDQQAQMPQEAQQPTEDQAEETVMHDDVVQ
FT                   DLLLDDHSLTMLANNPELNGGNGNDILHGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSG
FT                   DDDGGVDTITDFKANPVDKSSDASVLNLSDLLSDADLETNSLDNYLNVSTTEEGDTAIK
FT                   VDPNGNGNFDAPAQTIILEDVDLTAVFATNNSHDIVNQMIANGNLIVEQ"
     atgttagctg aatctgttat cggtatagta agagccgtca atggactact agaaaaagta        60
     aatgtgcaag gacaagcaag cttagtaaag tctggcgctc gattagagga aggggacgtc       120
     ctgactttat taagtggtga ggcttacata caatttatta atggatttcc tgaagcatta       180
     gccttagaaa aaccggtcaa gctagatggt gtttccccaa cattacagta tggtgcggaa       240
     gatttaaaag aacaaatggt gcaagaagcg atagccaaag gtattgatcc ttcagtcata       300
     cttgatgttc ttggctcagc agcagcaggt gccgaggcgg tgggatcagg aggcgatgca       360
     tttattatgg atcctttgtt tggcttcgga catgtcacag caggatatcc caccggacct       420
     atttcctttg cttatgaggc agatactcag caattatttt ggtttgtgcc agaagagaca       480
     ggggcgattg cagaatccga attgactcaa gagcctgaat ctatcccgca aattcctcaa       540
     ttcaccacaa atcaagcagt gctaacagtt tttgaggatg ctttgccaag tggtattcct       600
     gattcagcag ggcaagcaag aatcgcaagt tcttctctaa gtactttgct gacctcttca       660
     ccagacgttg ttgcttcctt tgcttttaat accaatttaa gtgttcttcc tacattaaag       720
     tcaggtggta tagaccttga ttataatcta tcctctgata aacgtacctt aacagcatca       780
     atccctggcg gggcagcggt catgcaattt gagttgacag cagatggaca attaactcaa       840
     acattaatgg actcgattga tcacccaaca gctgatagcg atgacagcga atggatgaga       900
     ttagacctgt cacctttaat tgatgtgact ttcacaagaa caagtgatgg cagtgtttta       960
     gagtcaagaa cactgcctgc taatgcagtt gttgcaggaa ttcaagacga tgttccaata      1020
     gcaagagctc aattgaccaa taatgaaatc ctgttggatg aaactatagg aatgaaagcc      1080
     ggtgatgctg atgcagctaa tgatgatttt aatccaacga ctactgtgga tccttttaat      1140
     aatacttatg gtatacccat aggtctggtc caaaatgcaa acctccttga taccagtact      1200
     tctgaaatgg ggggggatta taaaaatgca acaatgaccc atttactaaa aattactgat      1260
     gctgtttcag gattacagac aaccgatggc actcctatca atcttttttt ggaatcgaat      1320
     ggtgatatta gcggaagagc aggtgacatt ggtgctcctg cagtttttgc aattcgcatg      1380
     aacccaaata ctggtgcaat taccgttgcg cagtatggtt caattaaaca atttgatacc      1440
     aacagccatg atgaagcggt tgatttaaca ggacgtattt cagctgtagt gagagtaaca      1500
     gatggtgatg gtgacgtatc taatgcagaa atacctatag gacaacggat tgtttttgaa      1560
     gacgacgggc ctattgctca aatagccgcc acgggtgtca aagtgactca cgatgaaacc      1620
     gccggtgtgg atgctggcag cgacgacgtg gccagtcctt tggctttgtt tgccggggtt      1680
     agtcaaaaat ctacggatat ggccggcttt gcccaaagca gcggggctgt agtgagctct      1740
     gctggcagct tggttggtca agacaacgaa ggggctacca ttaaattttc tttagcgata      1800
     gccaatgcag cgagcggatt acaaaccacg gacggggatg ccatcacctt gacgcttgaa      1860
     agcggttttg tagttggacg agacgcaggc ggcgatgcgg tgtttgcgat tgccattgat      1920
     gccgataccg gggtcttaag cctggctcaa tacgaatcta ttaaacaccc atcaggtggg      1980
     gcttcttatg acgaagccgt ggatttgtcc ggcaagatca acgcggtggt gacagtgacc      2040
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      2100
     gacgacgggc ctgttgctca aatagccgcc acgggtgtca aagtgactca cgatgaaacc      2160
     gccggtgtga atgctggcag cgacgacgtg gccagtcctt tggctttgtt tgccggggtt      2220
     agtcaaaaat ctacggatat ggccggcttt gcccaaagca gcggggctgt agtgagctct      2280
     gctggcagct tggttggtca agacaacgaa ggggctacca ttaaattttc tttagcgata      2340
     gccaatgcag cgagcggatt acaaaccacg gacggggatg ccatcacctt gacgcttgaa      2400
     agcggttttg tagttggacg agacgcaggc ggcgatgcgg tgtttgcgat tgccattgat      2460
     gccgataccg gggtcttaag cctggctcaa tacgaatcta ttaaacaccc atcaggtggg      2520
     gcttcttatg acgaagccgt ggatttgtcc ggcaagatca acgcggtggt gacagtgacc      2580
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      2640
     gacgacgggc ctgttgctca aatagccgcc acgggtgtca aagtgactca cgatgaaacc      2700
     gccggtgtgg atgctggcag cgacgacgtg gccagtcctt tggctttgtt tgccggggtt      2760
     agtcaaaaat ctacggatat ggccggcttt gcccaaagca gcggggctgt agtgagctct      2820
     gctggcagct tggttggtca agacaacgaa ggggctacca ttaaattttc tttagcgata      2880
     gccaatgcag cgagcggatt acaaaccacg gacggggatg ccatcacctt gacgcttgaa      2940
     agcggttttg tagttggacg agacgcaggc ggcgatgcgg tgtttgcgat tgccattgat      3000
     gccgataccg gggtcttaag cctggctcaa tacgaatcta ttaaacaccc atcaggtggg      3060
     gcttcttatg acgaagccgt ggatttgtcc ggcaagatca acgcggtggt gacagtgacc      3120
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      3180
     gacgacgggc ctgttgctca aatagccgcc acgggtgtca aagtgactca cgatgaaacc      3240
     gccggtgtgg atgccggcag cgacgacgtg gccagtcctt tggctttgtt tgccggggtt      3300
     agtcaaaaat ctacggatat ggccggcttt gcccaaagca gcggggctgt agtgagctct      3360
     gctggcagct tggttggtca agacaacgaa ggggctacca ttaaattttc tttagcgata      3420
     gccaatgcag cgagcggatt acaaaccacg gacggggatg ccatcacctt gacgcttgaa      3480
     agcggttttg tagttggacg agacgcaggc ggcgatgcgg tgtttgcgat tgccattgat      3540
     gccgataccg gggtcttaag cctggctcaa tacgaatcta ttaaacaccc atcaggtggg      3600
     gcttcttatg acgaagccgt ggatttgtcc ggcaagatca acgcggtggt gacagtgacc      3660
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      3720
     gacgacgggc ctgttgctca aatagccgcc acgggtgtca aagtgactca cgatgaaacc      3780
     gccggtgtgg atgccggcag cgacgacgtg gccagtcctt tgtcggtgtt tgtgggtgtg      3840
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      3900
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      3960
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      4020
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      4080
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt      4140
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca acgcggtagt gacagtgacc      4200
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      4260
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      4320
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      4380
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      4440
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      4500
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      4560
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      4620
     gctgatacgg gcgtgttaag cgtggctcaa tacgaatcta ttaaacaccc aacaggtggg      4680
     gcttcttatg acgaagccgt gaatttgtcc ggcaagatca acgcggtggt gacagtgacc      4740
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      4800
     gacgacgggc ctgttgcgca gattgcggca accgggacga aggtcattca tgatgaaacg      4860
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      4920
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct      4980
     actggcagtg tgacgggtca ggacaacgaa ggggctacca tcaaattttc tttagcgata      5040
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      5100
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      5160
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt      5220
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc      5280
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      5340
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      5400
     acaggccttg atgccggcag caacgacgtg gccagtcctt tgtcggtgtt tgtgggtgtg      5460
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      5520
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      5580
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      5640
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      5700
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcta ttaaacaccc aaccgggggt      5760
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc      5820
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      5880
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      5940
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      6000
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      6060
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      6120
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      6180
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      6240
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt      6300
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc      6360
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      6420
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      6480
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      6540
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      6600
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      6660
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      6720
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      6780
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcta ttaaacaccc aacaggtggg      6840
     gcttcttatg acgaagccgt gaatttgtcc ggcaagatca acgcggtggt gacagtgacc      6900
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      6960
     gacgacgggc ctgttgcgca gattgcggca accgggacga aggtcattca tgatgaaacg      7020
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      7080
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct      7140
     actggcagtg tgacgggtca ggacaacgaa ggggctacca tcaaattttc tttagcgata      7200
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      7260
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      7320
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt      7380
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc      7440
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      7500
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      7560
     acaggccttg atgccggcag caacgacgtg gccagtcctt tgtcggtgtt tgtgggtgtg      7620
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      7680
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      7740
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      7800
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      7860
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt      7920
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca acgcggtagt gacagtgacc      7980
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      8040
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      8100
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      8160
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      8220
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      8280
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      8340
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      8400
     gctgatacgg gcgtgttaag cgtggctcaa tacgaatcta ttaaacaccc aacaggtggg      8460
     gcttcttatg acgaagccgt gaatttgtcc ggcaagatca acgcggtggt gacagtgacc      8520
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa      8580
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      8640
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      8700
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct      8760
     actggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      8820
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      8880
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      8940
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcta ttaaacaccc aaccgggggt      9000
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc      9060
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      9120
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      9180
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      9240
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      9300
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      9360
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      9420
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat      9480
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt      9540
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca acgcggtagt gacagtgacc      9600
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa      9660
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg      9720
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg      9780
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct      9840
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata      9900
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa      9960
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     10020
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt     10080
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca acgcggtagt gacagtgacc     10140
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa     10200
     gacgacgggc ctgttgcgca gattgcggca accgggacga aggtcattca tgatgaaacg     10260
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     10320
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct     10380
     actggcagtg tgacgggtca ggacaacgaa ggggctacca tcaaattttc tttagcgata     10440
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     10500
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     10560
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggg     10620
     gcttcttatg acgaagccgt gaatttgtcc ggcaagatca acgcggtggt gacagtgacc     10680
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa     10740
     gacgacgggc ctgttgcgca gattgcggca accgggacga aggtcattca tgatgaaacg     10800
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     10860
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct     10920
     actggcagtg tgacgggtca ggacaacgaa ggggctacca tcaaattttc tttagcgata     10980
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     11040
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     11100
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt     11160
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc     11220
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa     11280
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     11340
     acaggccttg atgccggcag caacgacgtg gccagtcctt tgtcggtgtt tgtgggtgtg     11400
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct     11460
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     11520
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     11580
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     11640
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt     11700
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca acgcggtagt gacagtgacc     11760
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa     11820
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     11880
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     11940
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct     12000
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     12060
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     12120
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     12180
     gctgatacgg gcgtgttaag cgtggctcaa tacgaatcta ttaaacaccc aacaggtggg     12240
     gcttcttatg acgaagccgt gaatttgtcc ggcaagatca acgcggtggt gacagtgacc     12300
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa     12360
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     12420
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     12480
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct     12540
     actggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     12600
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     12660
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     12720
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt     12780
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca acgcggtagt gacagtgacc     12840
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa     12900
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     12960
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     13020
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct     13080
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     13140
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     13200
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     13260
     gctgatacgg gcgtgttaag cgtggctcaa tacgaatcta ttaaacaccc aacaggtggg     13320
     gcttcttatg acgaagccgt gaatttgtcc ggcaagatca acgcggtggt gacagtgacc     13380
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgatgcgat tgtttttgaa     13440
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     13500
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     13560
     gtcaacaagt ctacggacat ggccggcttt gcccaaagca gtggtgctgt agtgagttct     13620
     actggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     13680
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     13740
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     13800
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcta ttaaacaccc aaccgggggt     13860
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc     13920
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa     13980
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     14040
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     14100
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct     14160
     actggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     14220
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     14280
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     14340
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt     14400
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtagt gacagtgacc     14460
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa     14520
     gacgacgggc ctgttgcgca gattgcggca accggggcga aggtcattca tgatgaaacg     14580
     acaggccttg atgccggcag caacgacgtg gccggtccat tgtcggtgtt tgcgggtgtg     14640
     gtcaacaagt ctacggacat ggcaggcttt gcgcaaagca gtggtgctgt ggtgagttct     14700
     gcgggcagtg tgacgggtca ggacaacgaa ggggccacca tcaaattctc tttagcgata     14760
     gccaatgcgg cgagcggatt acaaaccacg gatggggatg ccatcacctt aacccttgaa     14820
     agcggccttg tggtgggtcg tgatgcgagt ggcaaggctg ttctggcgat ttcaattgat     14880
     gctgatacgg gcgtgttaag cgtggcccaa tacgaatcca tcaaacaccc aaccgggggt     14940
     tcgtcctacg atgaggcggt gcacctgggc ggcaagatca atgcggtggt gacagtgacc     15000
     gacggcgatg gggatgtggc cacacaagcg ataggcatag gcgacaaggt ggtgtttgaa     15060
     gacgacgggc ctgtggcatc aaatattaca agatcaggat tagcaaatga gggtgctgat     15120
     acaaacctta tgctaattct tgatacttca ggaagtatgg cgggttcagg aattcaaacc     15180
     ttaattaatt cgactttgga attacttgag cgatatgagg cgcttggtaa cgtaaaagta     15240
     cgtattgtaa ctttcaacac aagtgcaacg gctattggct ctgtttggat gaccgtagat     15300
     gcagctaaaa atgcactcct tggacttact gcaggaggca atacaaattt tgatgcggca     15360
     cttattaccg ctatgaatgc atttaattct ggtactgttg gtggagctga tggaagaata     15420
     gggggagcac aaaatgtgtc gtattttatc tctgatggta atccaacagt taatcaagat     15480
     tggccaagta ttccaggtac attagcacaa aatgggattc agccaagtga gcaagctgca     15540
     tgggaagctt tcctgcaaga cacgaatggt gcatctgctg gtggcgaaaa aattagatct     15600
     tatgccttag gcatgggtac ggggattact gtcagcaatc ttgagcctat aggatttaat     15660
     ggggtaaatg gtacagatat tcctgctgtt gtcgttacag atattagtca actagacagt     15720
     gtattagcaa gtacaattac tgcaagccca attagcggta ctttgatctc ggatcctaac     15780
     cctggtgtta actttggagc tgatggaggg cacgttcaat ctgttacagt gaatggtata     15840
     acttatactg ttaatgcaaa tcttagttct ctttctacaa gtggttctgc tactcaagga     15900
     tcaaatactc attcctacga taattcaacg catgtgttaa cagtaacaat tagcacgggt     15960
     gaatcgctta ctatagacat ggataatggt agttatacat ttacaccacc agcaaatatt     16020
     accagctcaa taaaccgcat aatcaactat gttctagttg atggtgatgg tgatacggct     16080
     gctgcgacaa ttacttttaa cattgatatt tccggattca atgatccgtt ggtagtacgt     16140
     gatgatttag ttcttaccaa tcaacccgct gtaagtggtc aagatgtcat ttctataccg     16200
     acatgggcat tattagccaa tgatacgggt ggaagtggcg tgtcttcagt cagcagtgtg     16260
     acacaaccag ttgctgaagg tactgtagtt ctcaatgctg gttctgtagc ttttaccgaa     16320
     gaatctaata gtgcagccga tggtacctac aatggaagta catctgatcc ttttaggtac     16380
     actaatacga caggttctca atcagcaacc gctaaggttg atctggatcg tacacaagca     16440
     ggggaaaata ggttagatgg aacctacaga agcgagattt tattaggtag agatacttcg     16500
     aatgacacaa ttattggtaa tgatggtaat gatatactga ttggattagg tgggaatgat     16560
     actttaagtg gtggtaatgg tgatgatatt cttgctggtg gcgctggtaa tgatacgtta     16620
     gatggtggtg caggcaatga tacagctact tacattgacg ccactgcagg tgtaactgtt     16680
     tccttaaata ccagttctgc acaaaatact gttggtgcag gaacggatac acttaccaat     16740
     atagaaaatc taaccggttc caaatttaat gatactctaa ctggaaataa tagtgccaat     16800
     acaatcaaag gattggaggg taatgataca ataagtggat taggtggaaa tgatacttta     16860
     gatggcggtt ccggagacga tgtcattatt ggtggattgg gtgatgatat actcaccggc     16920
     ggatcagggg ctgatcaatt tgtgcttgtg aaagggcaag gtggtgctag tgcaggcgca     16980
     gccccaatcg atactattac agactttgaa gtgaacattg ataagattgt tattaacggt     17040
     aataacatta ctggtgtcag tgtatccact ccggtttcta acacttatac tataacggtt     17100
     aattattctg atgctgctac ggaacacttt aaagtgacat tatccaatgg cgctgttttg     17160
     aatgattcag gaaaaactca tttgaacgga gtggttataa gcggcggcac cgctaccatt     17220
     gatggcacaa tcgttggcgc agttctatat ttggatctga atgctaataa tcaggaggat     17280
     gaaggtgagc gacttggtat taccaatcaa tatggtcatg tagaatgggt cgttgatctg     17340
     agtaaattcg atgtcaacgg tgatggtcag tatgttatag gcgaggctcg tgctgttcaa     17400
     accggtggtt ttgatataga tacaggtctt agctatgaaa taaatcttta cgggccagta     17460
     ggttcagcag ttatatcgcc cttgacaagt ctcttgcaag cgcagctaga agccggtatg     17520
     gattatgaga cagctaatgc tgcgttggtt gctcgcttag ggttaccaga gggaacacaa     17580
     attattagtt tcaatccgat tactggtagt ggagaagtcc tggctcaaaa cgcaggtgta     17640
     atgacagctg ccattcagtt tgctgaaata gccgcaatac actattcaac cgatgaaggt     17700
     catgtttcat tcgctgtctt tgaggcaatt agcaaggcat tgcttgaact tcctgaaggg     17760
     gtagtcgctg attttggcga tgagggtttc ttgcagtcca tttcaaatta tctgggatta     17820
     gatgctctgg ttacatctga tatgattgac tatatggcaa ccagccagaa agcgttagag     17880
     gccagtattt tgactcttgc gcccggagaa gatgctctga cggccatcag caagatacag     17940
     catgtgaccc aaggtatata tgcccaggct attgaaatgg cattgatagg gtatttgcca     18000
     ttagatgctc ttaaaaacat gagtgctgtt cttaaggctt atgctgatgg agatattacg     18060
     gatgaacaac tcaactcctt tgaagataag ctttctgctg tgattgtgaa ttgggaagat     18120
     aacaatgtta cagacacatc tcatcaggct acattgcaaa cagagcgtac tgttgatgac     18180
     tcttcagtca aatcagaggt gaatcatgaa atggcgcaag aagttaatgc cgtgattaat     18240
     gattttatgg atgaacataa tatttctttg tactattatg atcaacaggc tcaaatgcct     18300
     caagaagcac aacaaccaac agaggatcag gctgaagaga cggtcatgca tgacgacgtt     18360
     gttcaagatt tgttgcttga tgatcatagc cttaccatgt tggctaataa tcccgaatta     18420
     aatggtggta atggcaatga tattctgcat ggcactaccg gaaacgattt tataagaggt     18480
     ggtcaaggaa atgatacgat gacaggtggt ggcggtgttg ataccttctt ctggttaagt     18540
     ggcgatgatg atggtggtgt ggatactatt actgatttca aagcaaatcc agttgataag     18600
     tcatccgatg cgagcgtcct taacttaagt gatttgctat ctgatgctga tctggaaacc     18660
     aatagtttgg ataattatct gaatgtttct accacagaag agggtgacac agccattaaa     18720
     gtagacccta atggtaatgg aaactttgac gctccagcgc aaacgattat attagaagac     18780
     gtggatttaa cagctgtttt cgctaccaac aattcgcatg atattgtgaa tcaaatgatc     18840
     gctaatggaa acttgatagt agaacagtaa                                      18870
//

If you have problems or comments...

PBIL Back to PBIL home page