(data stored in ACNUC7421 zone)

EMBL: CP000675.PE752

CP000675.PE752       Location/Qualifiers
FT   CDS_pept        complement(811130..811852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2637"
FT                   /product="outer membrane protein, OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2637"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56551"
FT                   /protein_id="ABQ56551.1"
FT                   /translation="MIKSLIKGVDMSRKLAKTRILGYGLMICFLAGCFHPPYNNFQPDR
FT                   RAVKRVGVDTGIGAVAGVIASGTASGTLIGAAAGGTVGLVASIYRDSKRKIIRDLQKQD
FT                   IQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNV
FT                   GSRSHKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEI
FT                   QWFTSPAQPPQPQMAYVK"
     atgattaaat cattgattaa aggagtggat atgtcacgca aattagccaa aacacgaatc        60
     cttggttatg gattaatgat ttgctttctt gcgggctgct ttcatccccc ttataacaac       120
     tttcaacccg atagacgagc tgttaagaga gtaggagtag atacagggat tggtgctgta       180
     gctggggtaa tagccagtgg tactgcttca ggaactctta ttggggcagc ggctggtggt       240
     accgtaggtc tggttgcgag tatctaccgt gacagcaaac gcaaaatcat cagagatctg       300
     caaaagcagg atattcagta tgttgaatat ggagatacca gaacattaat tattcctaca       360
     gacaaatatt tcatgtttag cagccctcgc cttaatgaaa tatgctatcc tggcctaaac       420
     aatgtcatca gactgttaaa tttttatcct caaagtacga tttatgttgc cggatttact       480
     gataatgtcg gatcacgcag ccataagaga aaactttctc aagctcaagc tgaaacaatg       540
     atgacttttc tctgggctaa tggtattgca gccaaaagac taaaagcaga aggctatgga       600
     gataagaatg cgatttctga caatgctatt attcatggaa gcgctcagaa cagaagaatc       660
     gagatccagt ggtttacaag ccctgctcaa cccccacaac cacaaatggc ttatgtaaaa       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page