(data stored in ACNUC7421 zone)

EMBL: CP000675.PE753

CP000675.PE753       Location/Qualifiers
FT   CDS_pept        812053..817260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2635"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56550"
FT                   /protein_id="ABQ56550.1"
FT                   /translation="MKIPVQLKNIGGNIPENDIALQVSYFIKSQNDELLPQSDAYIAPA
FT                   SGKIDVSFGNNLARNKDVFFAVALKSNNILAQTSTSATQLKDEVPITMEFDYSPLVLSE
FT                   PDDQIVSPRPLFVYGRLLDKQGKKKLEDVQIIFEATRANDGGLQPIASVRTEADGYFFI
FT                   EYPQGSFIDASARVGLPLRENPIPVRLDEVRIDGDISNKVFPRNVILVAELMEAEEATV
FT                   EKECGCEVLDVHESKRILEEYSFYSVVRTTEPEILGYVLKEEDEITLDEVLTQHPIRIW
FT                   EIIDPIFQLPAFSHLANRARVNLPEVTERSINTEITTRAHGRANTAPNPPQDNELAETL
FT                   KQIKINRGVLNNFLQRETNITKDNIVNLIEMNESYRFKQKMTLGETKPLGRVVLNSENS
FT                   VDWDLEPTLYQAVSVAHGHLLHFKSEWIADGYSLGDLLYSLPLAPGQKKQIVVFDWERR
FT                   ESATNIQSLEYEESLYNSLSRDRDIFEITKGVIEENIKGKSSATTASASAGIGGVVGGL
FT                   LFGVSGGVGHSGSTASQNSLRQTSASDLQKIRDRIVQSANAVRSQRSSVIQTVSQGERF
FT                   EVSSETVANYNHCHAITIQYYEVLRHFKVRQRFAEARECLFVPLLMSQFELNKLLRWRE
FT                   SLQFALLNTNLSKGFDAAERIKNKWIGSNFPGGTFASEKILNASGNFQIKFIIRRPDDK
FT                   MVEVDDYSKPIYGGQNMIIGYQKKTVEDINEANWQSLIPVMGSDTPKVFYDHHLRHAKN
FT                   KDEVCHRLLAEKIATAFVGALTFHVADETGNEISSISFDTTLTSKYRKEGVLNVSVRFM
FT                   GPSQFSRDKVHYIKIRCGTANVLPDYSSIIVTSGFIRYKTPHYEGFLCRFQSIYDDLSP
FT                   SDGVTLYAGPSLDELRDPRKEDIALVNSLIDHLNDNLEWYHKAIWQLMPAERRFLLLDG
FT                   IVLPGSKGLGRSLASLVENELIGIVGNSLVFPVAKGLNLDPNFGASDSLTDYYMVAAGD
FT                   PVNVSIPTKGVYAEAMMGRCNSCEEKDESRFWRWEESPIPDTPTTINPISTESRRAEPG
FT                   NLQPTAFPNPMVNIQNAPNAPDPTGLAGTLSLLGKGDSFRDITGLTQNQTNALEALKAS
FT                   FDATKTFGQEAAKLEIQKMMDKRLDNAIKAINNNPNLDPKQKMELTEKALNAYLGAGAN
FT                   TTQPPKDANADKLQEGINKNLDKVNSSKSGEISVTKPDGTKVNTKFDGGTTSPAIETKI
FT                   GKGGITPMKQENSNACWATVATMMLRWKDSKNYTIEEVLTKAGSQYLNYYKQKTGLPYT
FT                   EKQNFITSLGMRGEPLANYTAQNYRDWLVEYGPLWVTTDTDQSKGFSAHALIITGISSD
FT                   LKSLEVIDPLQGRKFVQSFEEFANAFKELITDSGLLPTTQVVHFLEKIEATEGAPTPAD
FT                   IVKSLNEYNPSSSETLVINMVEFNTGISGITNYKDWKTDGSVIHNKRKNAYRDPFGIKH
FT                   LVLHETAAESGDGFDDSNNETSHMSVKRDATILQFNDLVEFENHGSGMNTTSIGIEFVN
FT                   RGWLSSSTADGGEGIPAKESSLTAAQKETYKEANGYLWAFWGYGFNIYRVPPSIDQLEK
FT                   EVELVKWLTRDFPALLQSISGISIYNLFPSIDDTWLQLVSYAEVKDIWTFKAADIPPEA
FT                   ERTEKNLFVMTTGYEYLEPSYLTDKSGIISHNAFYENHSDGSFLTLYTWLRLEKGKSKT
FT                   DALDIAKKLMKDHFIRVSLTSNTDKKIILLNVKDGNLV"
     atgaaaattc cagtccaact caaaaatata ggcggtaata tcccagaaaa tgatattgct        60
     ttgcaagttt cttattttat taaatctcaa aatgacgaat tgcttcccca aagtgacgct       120
     tatattgctc cagcttcagg caagattgat gtcagctttg gaaataatct cgcgcgaaat       180
     aaagatgttt tctttgctgt tgcattaaaa agcaacaata ttttggctca aacttccaca       240
     tctgctactc aactaaagga cgaagtacct atcacgatgg agtttgatta cagtccactc       300
     gtattatcag aacctgacga tcaaattgtt tctcccaggc cattatttgt ttatgggcgc       360
     ttgcttgata aacagggcaa gaaaaaactg gaagatgttc aaatcatttt tgaggctact       420
     cgtgctaatg atggagggtt acagcccatc gcaagcgtaa gaacagaagc agatggttat       480
     ttttttattg agtatccgca aggtagtttt attgatgcca gtgcccgagt gggtttgccc       540
     cttcgtgaaa acccaatccc tgtccggctt gatgaagtta ggattgatgg cgacatttcg       600
     aataaagtat ttcctcgcaa tgttatttta gttgcggaat taatggaagc tgaagaagca       660
     actgtcgaga aggaatgtgg ctgcgaggta ctggatgttc atgagagtaa aagaattttg       720
     gaagaatatt ccttttatag tgtggtgcgc accactgaac ctgaaatatt gggttatgtc       780
     ttaaaagaag aagatgagat tactttggat gaagtattaa cccagcatcc tatccgtatt       840
     tgggagatta tcgatcctat ttttcaatta cctgcattta gtcatcttgc aaatcgtgca       900
     agagtaaacc tgccagaagt cacagaaaga agcatcaata cggaaataac aacaagagcg       960
     catggccgcg caaataccgc acctaatccg ccccaagaca atgaactggc tgaaacttta      1020
     aaacagatta aaattaatcg cggtgtttta aataattttt tacaaagaga aaccaatatc      1080
     accaaagata acattgtcaa tctcattgaa atgaatgaaa gttatcgctt taagcaaaaa      1140
     atgactttgg gagaaacaaa accgctggga agagtcgtat tgaattccga gaattccgtg      1200
     gattgggatt tagaacctac tctatatcag gccgtatcag ttgctcatgg gcatttactg      1260
     cattttaagt cagagtggat cgcagatggt tattctcttg gagatctcct ttatagctta      1320
     ccattggcac caggccagaa gaaacagatt gtagtatttg attgggaacg aagagagtca      1380
     gctaccaata tacaatcttt agagtatgaa gaaagtttat acaactcact tagccgcgat      1440
     agagatatct ttgaaatcac gaaaggagtg attgaagaaa acataaaagg caaatcgagc      1500
     gcaactaccg caagtgccag cgcaggcatt ggaggagttg tgggaggttt gcttttcggg      1560
     gtttcaggtg gagttggcca ttctggctcg actgcctctc aaaatagtct aaggcaaacc      1620
     tccgcaagtg atttgcaaaa aattagagat cgcattgtac aatcagccaa tgccgttcgt      1680
     agccagcgct cttcagtaat tcaaacggtt tcccagggtg agcgttttga agtgtcgtct      1740
     gaaacagtgg ctaactataa tcattgccat gccattacaa ttcagtacta tgaggtatta      1800
     cgtcatttta aagtgcgtca gcgttttgca gaagcacgcg aatgcttgtt tgttccactt      1860
     cttatgagtc aatttgagtt aaataaatta ttacgttggc gagaaagtct tcaatttgcc      1920
     ttattgaata ctaatttgtc aaaggggttt gacgctgcag aaagaattaa aaataaatgg      1980
     atcggtagca attttccagg aggaaccttc gcctccgaga aaattcttaa tgcatcaggc      2040
     aacttccaaa tcaaatttat tatccgcaga cctgatgaca agatggttga agtggatgat      2100
     tattcaaagc ctatctatgg tggccagaat atgattatcg gatatcagaa aaaaacagtc      2160
     gaggatatca acgaagcgaa ttggcaaagt ttaattcctg ttatgggatc agatactccg      2220
     aaagtgtttt atgatcatca tttaagacat gcgaaaaaca aggatgaagt atgtcaccga      2280
     ttgcttgcag agaaaattgc aacggcattt gttggtgctc tcacgtttca tgttgcggat      2340
     gagacaggta atgaaatttc ctcaatctcc tttgatacga ctctgacttc aaaatataga      2400
     aaagaaggtg ttttaaatgt ttctgtgcgg tttatgggac cttcacaatt tagcagagac      2460
     aaagtgcatt atattaaaat tcgttgtggt acggccaatg tgttacccga ttattcgtca      2520
     attatcgtca cttcaggatt tataagatac aagacgcctc actatgaagg ctttttatgt      2580
     cgtttccaaa gtatttatga cgatttatct cctagcgatg gtgtaacgct atatgctggt      2640
     ccttcactcg atgagttacg tgatccaaga aaagaagata ttgctctggt gaattcgctg      2700
     attgatcatt tgaacgataa tttggagtgg tatcacaaag cgatctggca actgatgcct      2760
     gctgaaagaa gatttttact cctggatggt atcgtattac ccggtagtaa aggtttgggt      2820
     agaagcctgg catctctggt ggaaaatgag ctaattggta ttgtaggtaa tagcctggtt      2880
     tttcctgtgg caaaaggatt aaatctggat cctaattttg gtgcttcgga ttctcttact      2940
     gattactata tggtggctgc tggtgatcct gtcaatgttt caatcccaac gaaaggtgtg      3000
     tatgccgagg cgatgatggg acgttgcaat tcttgcgaag aaaaagatga aagtcgcttc      3060
     tggcgttggg aagagtctcc tatacctgac actccaacaa caatcaatcc aatcagtacc      3120
     gagagtcgaa gagcggaacc cggtaacttg caaccgactg cttttcccaa tcccatggtt      3180
     aatattcaaa atgcaccgaa tgcccctgat cccactggtt tggcaggaac attgtcttta      3240
     ttagggaaag gagattcatt cagagatatt acaggtctta ctcaaaatca aaccaatgcg      3300
     ttggaggcct tgaaagcatc ctttgatgcg accaaaacat ttgggcaaga ggcggcgaaa      3360
     ttggaaattc aaaaaatgat ggataaacga ttagacaatg cgattaaagc gattaataac      3420
     aatccaaatc tggatccaaa acaaaaaatg gagctcacag aaaaggcatt aaatgcttat      3480
     cttggcgcag gagccaatac aacgcaaccg ccgaaagatg ccaatgccga caagttgcag      3540
     gaaggcatta ataaaaacct ggataaagtg aacagcagca agagtggcga gatatctgta      3600
     acaaaaccag atgggactaa agtcaataca aaatttgatg ggggtaccac gtctccagct      3660
     attgaaacca aaataggtaa aggcggcatt actcctatga agcaagaaaa cagcaatgcc      3720
     tgttgggcaa cagtcgctac catgatgttg cgatggaaag acagcaagaa ttatacaatt      3780
     gaggaggttt taacgaaagc tggatctcaa tatcttaatt attacaaaca aaagactggc      3840
     ttgccatata ctgaaaaaca gaattttatt acttctttag gtatgagagg agaaccctta      3900
     gccaattata cggcacaaaa ttaccgtgat tggttagttg agtatgggcc gttatgggtc      3960
     acaacagata ctgatcaaag caaaggtttt tcagcacatg cgttgattat tactggtatt      4020
     agtagtgact taaaatcttt agaggttatc gatcccttac aaggcagaaa gtttgttcaa      4080
     tcgttcgagg aatttgccaa tgcatttaag gagcttatta ctgacagtgg tcttttacca      4140
     acaacacaag tagttcattt cctggagaaa attgaggcaa cagaaggagc gccaactcct      4200
     gctgatattg ttaaaagttt aaatgaatac aatccctcca gctcagaaac cctggtaatt      4260
     aatatggttg aattcaatac gggtatttca gggatcacca attacaaaga ttggaaaaca      4320
     gacggttcag tgatacacaa caagcgtaaa aatgcttaca gagatccttt tggtattaag      4380
     caccttgtgc ttcacgaaac agcggctgaa agcggtgatg ggtttgatga ttccaataat      4440
     gaaacctcac atatgtcggt taaaagagat gcaaccattt tacaatttaa tgacctcgtc      4500
     gagtttgaaa atcatggttc ggggatgaac acgaccagta ttggcataga gtttgtaaat      4560
     cgcggatggc tatcttcttc tacagccgat ggcggtgaag ggatacctgc gaaagaatcc      4620
     agcctgactg cagcacaaaa agaaacctac aaagaggcta atgggtattt atgggcattt      4680
     tggggatatg gttttaacat ttatcgtgtt cccccgtcta ttgatcagtt agaaaaagag      4740
     gtggaacttg tgaagtggct caccagagat tttcctgcct tattgcaatc catcagcggt      4800
     atttctattt ataacctttt cccctcaatt gatgatactt ggttacagct tgtctcttat      4860
     gctgaggtga aagatatatg gactttcaaa gcagcagaca tacctcctga ggcagaaagg      4920
     actgaaaaga atctctttgt tatgacaaca ggatatgagt atctggaacc cagttactta      4980
     acagataaga gtggaattat ttcacataat gccttttatg agaatcacag tgatggttct      5040
     ttcttgacat tatatacttg gttgcgtttg gagaaaggaa aatcaaaaac agatgcgttg      5100
     gatattgcca agaaactgat gaaggatcat ttcattcgtg tttctttaac gagtaataca      5160
     gacaagaaaa taattttgct gaatgtcaag gatggtaatt tagtttga                   5208
//

If you have problems or comments...

PBIL Back to PBIL home page