(data stored in ACNUC7421 zone)

EMBL: CP000675.PE756

CP000675.PE756       Location/Qualifiers
FT   CDS_pept        820262..821383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2632"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56547"
FT                   /protein_id="ABQ56547.1"
FT                   /translation="MNIRYLKALVIKETLQIIRDPSTILIAFVLPLILLFIFGYGVNLD
FT                   TDQVKFGLALESYDSSTVSLSQSFSSSRFLDVSISTNRQAFRYGLVNGTIRGFIDIPQR
FT                   FTADSLSGNPKPALQNIVDGSYPQVAGFAENYALGALQTWISSQAYEHGQMTLKSGINL
FT                   EPRYWYNQELKSRNFLIPGSIVIVMTLIGTLLTSLVIAREWERGTMEAMMATPISIVDI
FT                   ILGKLIPYFVLGMGSMFLCTIIATWYYGVPFQGTLLALTLVSAVFLVAALGQGLLISTL
FT                   ARDQFVASQLALMSAFLPSFILSGFIFEINSMPKWIQLLTHLFAARYFVTSLQTLFLTG
FT                   NIWSLLIRCLFAIALIGFAFFFITAHKTRKRLD"
     ttgaatattc gctatctaaa ggcattggtc attaaggaaa ctctgcaaat tatccgtgat        60
     cccagtacta tattaattgc ctttgtattg cctttaattt tgctttttat tttcggttat       120
     ggtgttaatc tggacactga tcaagtcaag tttggcctgg ctttagagag ttatgattcg       180
     tcgactgtca gtctttctca atcttttagc agttcccgat ttttggatgt atctatttca       240
     acaaacagac aagcgtttcg ttatgggttg gttaatggaa caattcgtgg ttttattgat       300
     attcctcaac gtttcactgc tgatagtctg agtggaaatc ccaagccagc tctgcaaaac       360
     atagttgatg gttcttatcc gcaagttgcc ggttttgcag aaaattatgc gcttggggct       420
     ttgcaaacct ggattagctc ccaagcttat gagcatgggc aaatgacact taagtccggc       480
     attaaccttg agcccagata ctggtacaac caggagctaa aaagcagaaa ttttcttatt       540
     cctggctcaa tagttattgt tatgactttg attggaacat tactcacctc gctggtgatc       600
     gctcgtgagt gggagagagg tacgatggag gcgatgatgg caacgccaat ttctattgtt       660
     gacatcatct tgggaaaatt aataccctat tttgtgctag ggatgggttc catgttttta       720
     tgcactatta ttgcaacatg gtattatgga gtacctttcc aaggtactct tttggcactg       780
     acattagttt cagccgtctt tctggttgct gctttagggc aggggttatt aatatctact       840
     cttgcaagag accagtttgt ggcttcgcaa ttggctttaa tgtctgcgtt tttgccttca       900
     tttattcttt ccgggtttat ttttgaaatc aattcgatgc caaagtggat acaattactc       960
     acgcatctgt ttgctgcacg ttattttgtg acaagtctgc aaaccttgtt tttaacgggt      1020
     aacatttggt ctcttttgat tcgttgcctt tttgcgattg cactgattgg atttgcattc      1080
     ttttttatta ccgcgcataa aaccagaaaa aggcttgatt aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page