(data stored in ACNUC7421 zone)

EMBL: CP000675.PE757

CP000675.PE757       Location/Qualifiers
FT   CDS_pept        821383..822507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2631"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2631"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56546"
FT                   /protein_id="ABQ56546.1"
FT                   /translation="MAKLSPATRIFALVIKEILTLFKDPKGRIVLIAPPLLQLLIFSFA
FT                   ATMEIKNISIGILNQDSGKHGYEVIQRFIGSPTFSKVFFIQKQSDIKPIIDNQEAMVVM
FT                   TIPQDFSRKIESNSQANIQLILDGRRSNATQIVNGYISSIIENYNQEIQKTHGAIMMPP
FT                   VMVTRSWFNENLLYLWFTVPSLICILSMLISLVVTALSVARERELGTFDQLLVSPLTPY
FT                   EILIGKTIPAIIIGLAEGLLMWVAAVWLFDVPFYGSPLLMVYILFIFIMSTVGVGLFIS
FT                   SMCKTQQQAILGVFIYMVPVVTLSGYASPVENMPEWLQDLTWFNPLKFTLIAVIGIFLK
FT                   GMSALEVFITTWPLLLVGAVTLFIAGWFFKQRME"
     atggcaaaat tatctccagc aacaagaatt tttgctcttg tcattaaaga aatattgact        60
     ttattcaaag atcccaaggg acgaattgta ttgatagctc ctccactcct acagttattg       120
     attttttcct ttgcagctac tatggaaatt aaaaatattt ctataggcat tttgaaccag       180
     gattccggaa agcatggtta tgaagtgatt caacgcttta taggctcacc aactttttca       240
     aaagtttttt ttattcaaaa gcaatctgat atcaaaccta tcattgataa ccaggaagca       300
     atggttgtaa tgaccatccc acaagatttt tctcgtaaaa tcgaatcgaa ttcacaagcc       360
     aatattcagt taattttgga tggtcgacgt tctaatgcaa ctcaaattgt aaatggttat       420
     atcagtagta ttattgaaaa ctataatcag gaaattcaaa aaacgcatgg tgcaatcatg       480
     atgcctcccg tgatggtcac tcgaagttgg tttaacgaaa atttgcttta tctttggttt       540
     accgtccctt cattgatttg catcttatcc atgctgattt ctcttgtggt tactgcttta       600
     tcggtagcca gagaaagaga gctgggaacc tttgatcaat tattagtatc acctcttact       660
     ccctatgaaa ttcttatagg caagactatt cccgccatta tcattggttt ggcggaaggt       720
     ctcttgatgt gggttgctgc ggtttggcta tttgatgttc ctttttatgg ttctccgtta       780
     ctgatggttt atattttgtt tatttttatt atgtcaacgg taggtgttgg cttatttatt       840
     tcttctatgt gtaaaaccca gcagcaagct attttgggtg tatttatcta catggtgcct       900
     gttgtgacgc tttccggtta cgcttctccg gttgaaaaca tgccggaatg gctccaggat       960
     ttaacgtggt ttaacccatt aaaatttact ttaatagcag taattggcat ttttttaaaa      1020
     ggtatgtcgg ctttagaggt ttttatcaca acatggccac ttctattggt aggggctgtt      1080
     acattattta ttgctggctg gttttttaag cagcgtatgg agtaa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page