(data stored in ACNUC7421 zone)

EMBL: CP000675.PE758

CP000675.PE758       Location/Qualifiers
FT   CDS_pept        822516..823955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2630"
FT                   /product="multidrug efflux MFS outer membrane protein (RND
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2630"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56545"
FT                   /protein_id="ABQ56545.1"
FT                   /translation="MDRKLVLLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISS
FT                   SAPVHLTWWKAFHDPLLDRYINEAATNNLDIKAAEARIRQARAMQQISLANFYPQINGS
FT                   ASANSLQISKGTLEGIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKAS
FT                   LEEAYESRRTILLSTIAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVS
FT                   SEVDVSLAEGQLKNTESVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQ
FT                   KVPMGLRSDILRQRPDIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTL
FT                   FQSSSGFWLMGPQVSLPIFHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVR
FT                   YSQSLDTNHSLRAAIIANKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVS
FT                   SLTALISLYKALGGGWENFEA"
     atggacagaa aattagtgct actcttcagt atttcttgtt tatttggctg tactgtcggt        60
     cctgattatc aacgcccgga cattaaaatt caggagaaat ggccaacaag caaagtagag       120
     aaaaaaattt ccagtagtgc ccctgttcat ttaacctggt ggaaggcatt tcatgatcca       180
     ttgcttgatc gatacattaa cgaggcagct actaataacc ttgatatcaa agcagcagaa       240
     gctcgtatcc gccaagcccg cgcaatgcaa caaatttccc ttgccaattt ttatccgcag       300
     atcaatggat cagcaagtgc taattccttg caaatcagta agggtacgtt ggaggggatt       360
     tttgcaaact ctccaacata tactctaatt gatagaaatc aatggatata taatttgggt       420
     tttgatgcac aatgggagtt ggatttattt ggtaaaacaa gaagaaaagt tgaagcaagc       480
     aaagcaagcc tggaagaggc ttatgaatca cgccgtacca ttttactatc tacgatagcc       540
     gagatcgcaa gaagttatat agaattgaga ggcgcgcaac aattgtatgg tattgcgcaa       600
     aaaaatgtgg aattgcaaag aaaaacgttg gctcttgtcc gccaacgcta taaagcaggt       660
     gttagcagcg aagtcgatgt ttctttagcc gaaggccagt taaaaaatac agaatctgtt       720
     ttacccaatt atattaccca aatacaggta aatgcttatc aaattgccgt tatgctgggt       780
     aaagatccgc aaacaattct caaagatatt gcaaaaattc aatctttacc caaaccaccg       840
     caaaaagtac ctatgggatt acgttcagat attctgcgcc agcgtccaga cataagagca       900
     acagagaggc aattagcgtc tgccgtagct gaaattggtg tggcagttgc tgactttttc       960
     ccgcaattta atctttctgt ttccaatctt gcttttcaga gcacttctgt tgatacgtta      1020
     tttcaatcca gtagtggatt ttggctcatg ggtcctcaag tcagtttacc catatttcat      1080
     ggtggccaga ttagagctaa tgttgagagt aagaaggcgg ttgctcagca agcagcaata      1140
     caatacaaaa aaataatcct ccaggcattg caagaggctc aaagtgctct tgtccgctat      1200
     agccaatcgc tcgatacaaa ccatagcttg cgcgctgcca ttattgctaa caagcgagct      1260
     gtgcaatttg ccaagaaacg atttcaatac ggtgaggatg attatttatc actactgcaa      1320
     tcagaggctg ctcttctgaa tgccgagact caagaagtca attcggaggt ttcttcattg      1380
     actgctttga ttagtctata taaagcgctt ggcggaggtt gggaaaactt tgaggcttaa      1440
//

If you have problems or comments...

PBIL Back to PBIL home page