(data stored in ACNUC7421 zone)

EMBL: CP000675.PE76

CP000675.PE76        Location/Qualifiers
FT   CDS_pept        73291..74469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0076"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54076"
FT                   /protein_id="ABQ54076.1"
FT                   /translation="MLSVLSYRLSLLPKLSKTCYLLLLFSFLECVAGGIAYYLSLYLGT
FT                   STPLTKLQIGQVGSIVGFGALAGALCSTYITDKLNNKNIIIASFLFLGLGFFCLPQSMS
FT                   VLLISGCVFIIGFATSIFLTTNNTLLLQNAPQDQNSLRFIQSMKIVSENLGNSFSILLI
FT                   MFFAAQYYGQIFETIGLFFFLFALNTMKYLNVKQNSLEDSSYEEKETNQQGNNKRLYVT
FT                   ISAVFIVGIIYSQQRIAYPLFLHETFSSFTITAILFWLDPIIVSLFQIKITKIVSPLKI
FT                   SYQLAMGGLLLGTGLFALLIVDSIGGAIMACLTFILGEMLFMPTSFVRCYESAGNKRKG
FT                   MVAGAWRSAYSSGLIVGPFLSGFLMEYYSYNACWILAGILGFFLFILFSVKK"
     atgttatctg tactgtctta tcgattaagt ttactgccaa aattatcaaa aacttgctat        60
     ttacttcttc ttttttcttt cttggaatgt gtagcaggag ggattgcata ctatctatca       120
     ttatatttag gaacatcaac accattaaca aaactacaaa ttggtcaggt tggttcaatc       180
     gttggatttg gagcattagc aggcgcgtta tgttctactt acataacaga taaactcaat       240
     aataaaaata ttataattgc cagttttctc tttctaggtt taggcttttt ttgtttacct       300
     caaagcatga gtgttctgct tatatcaggt tgtgtcttca taattggttt tgcaacaagt       360
     atttttctta ccacgaataa taccctctta ttacaaaacg ctcctcaaga tcaaaatagc       420
     cttcgcttta tacaaagtat gaaaatagtc agtgaaaacc ttggtaatag cttttctata       480
     ctattaatta tgttttttgc agcgcaatat tacggtcaaa tttttgaaac aattggtcta       540
     tttttcttcc tttttgcact gaataccatg aaatatctaa atgtaaagca aaactcatta       600
     gaagactcct cttatgaaga aaaagaaaca aatcaacaag ggaataataa acgactttat       660
     gtaactatta gtgctgtatt tatagttgga attatctatt cccagcaacg aattgcatac       720
     ccactttttt tacatgaaac tttttcaagt tttactatta ccgcaatact tttctggtta       780
     gatcctatta ttgtttcttt atttcagatc aaaataacaa aaatagtatc cccattgaaa       840
     atatcttatc aattagcaat gggagggtta ttattaggta caggcttatt cgcattattg       900
     atagtcgata gtattggagg tgcaatcatg gcttgtttga cgtttatttt aggagaaatg       960
     ctatttatgc ctacttcctt tgtacgatgc tatgagtcag ctggaaataa gcgtaaaggc      1020
     atggttgctg gtgcatggag aagtgcttat tcctctggtc tgattgttgg cccttttttg      1080
     tcaggtttcc tcatggagta ttatagttat aatgcctgtt ggatattagc aggaatactt      1140
     ggttttttcc tatttatttt atttagcgtc aaaaaatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page