(data stored in ACNUC7421 zone)

EMBL: CP000675.PE761

CP000675.PE761       Location/Qualifiers
FT   CDS_pept        complement(826979..827443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2627"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56542"
FT                   /protein_id="ABQ56542.1"
FT                   /translation="MKALIAKTYLLADKIFDFLAPIFILLTRLYLAQVFFLSGLTKISN
FT                   WQATLSLFQNEYMVPVMSPTLAAYLGTACELGFPVLITLGLGSRLVLFGLFLFNLFAVF
FT                   SYQFLWTPDGAVGLTDHMQWGIMILMLLCTGPGKLSIDYLIRRFYLKLDN"
     atgaaagcac ttatagcaaa aacctatctg ctggctgata aaatttttga tttccttgcc        60
     ccaattttta tccttttaac ccgcctttat cttgcccagg ttttttttct atctggctta       120
     accaaaatca gtaattggca ggctactctt tctttattcc aaaacgaata catggttccg       180
     gtcatgtcgc ctactttagc tgcgtatctg ggaacagctt gtgaactggg ctttcctgta       240
     ttgattacat taggacttgg atccagactc gttttatttg gactttttct atttaactta       300
     tttgccgttt tctcttatca attcctatgg acgccggatg gtgccgttgg tcttaccgat       360
     cacatgcaat ggggaatcat gattttaatg cttttatgta ccgggccagg gaaattatca       420
     attgattatt taatcagacg attttatttg aaattagaca attaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page