(data stored in ACNUC7421 zone)

EMBL: CP000675.PE764

CP000675.PE764       Location/Qualifiers
FT   CDS_pept        complement(829086..829340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2624"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2624"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56539"
FT                   /protein_id="ABQ56539.1"
FT                   /translation="MNNISKITMAAVMAAGLSMATIPANADTPNDMEKCQGVAKAGKND
FT                   CGTAQHACAGQSKTDGSTTDWIYLPKGTCEKLVNGTVKS"
     atgaataata tttctaaaat aacaatggct gccgtgatgg ctgctggact ttcaatggct        60
     accatacctg ctaatgcaga tactccaaat gatatggaaa aatgccaagg tgtggccaaa       120
     gctggaaaaa atgattgtgg tacagctcaa catgcctgtg ctggtcaatc taaaacagat       180
     ggttcaacaa ctgactggat ttatctgccc aaaggtactt gtgaaaagct ggttaacggc       240
     acagttaaaa gctaa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page