(data stored in ACNUC7421 zone)

EMBL: CP000675.PE77

CP000675.PE77        Location/Qualifiers
FT   CDS_pept        complement(74470..75741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54077"
FT                   /protein_id="ABQ54077.1"
FT                   /translation="MKTINPVFFELVDKLSPDNKFAMYLVDYGYGDLVGDDDGIFLPTK
FT                   TGQYVRLDSEYTPPSMLNDLAYGLSNSPLGMFFNKSFEWFLNTSDEQINRTFPIYIDPP
FT                   GTFFSIGHIINYGYTATHLPNGVLFVTAGSKSNFMIPKIGCGIMHSRIQKNHNITKSAP
FT                   RSYHEHADIFQDIVKGNRDNNGWSASVLYFSENWIEKISKDSAWQEVRDYFYRISNHRS
FT                   EYAVNSDYYNHVYRVTNKRNNLKSNLLIYETARHLFEILLGAKLGFAPAMDDELLPLSI
FT                   IQEVYSECYKLEYLPIIAIPAYYNYRDPKPVYYSLQYPSLCSYSPKARNASTTLSDLIA
FT                   LIDVVHKYQKDFTLPIRECKNTILEEVSKITSFNFYHPATEENSIIKSPEIIPYQDERF
FT                   RGEKRFPINASFFKGCVSIFSNSI"
     atgaaaacca ttaatccggt tttttttgaa ctagttgata aactgtctcc agataataaa        60
     tttgcaatgt atctcgtaga ttatggttat ggagacttgg ttggcgatga tgatgggata       120
     tttttgccaa ctaaaacagg tcaatatgtt cgtcttgatt cagaatatac tcctccatcg       180
     atgttaaatg atttggctta tggtttgtct aatagtccat taggaatgtt ttttaataaa       240
     tcatttgagt ggtttttaaa tacctctgat gagcaaatta accggacgtt tcctatatac       300
     attgatcctc caggtacgtt ttttagtata ggacatatta ttaattatgg ttatacagca       360
     acccatttac caaatggggt tctttttgtt acagccggtt caaaatccaa ttttatgatt       420
     cccaaaattg ggtgtggaat tatgcattcg cgaatacaaa agaatcataa tattacaaag       480
     tcggctcctc gctcttatca cgagcacgct gatatatttc aagatatagt taaaggtaac       540
     agggataata atggttggag tgcgtctgta ttatattttt ctgaaaattg gattgaaaaa       600
     atcagtaagg actctgcatg gcaggaagtt agagattatt tttacaggat ttcaaaccat       660
     cgatctgaat atgctgtaaa tagcgattat tataatcacg tttatagagt taccaataaa       720
     agaaataatt taaaatccaa tttattaatc tatgaaacag cacgacatct ttttgagata       780
     ctgctaggcg caaaacttgg ttttgcgcct gcaatggatg atgaattact cccattatct       840
     attattcaag aagtttattc agaatgttat aagttagaat atttgcccat tatagcaata       900
     cctgcatatt ataattaccg ggatcctaaa cctgtttatt attctcttca gtatccctct       960
     ctatgtagtt attcacccaa agcaaggaat gcatcgacca ccctttcgga tcttatcgct      1020
     ttaattgatg ttgttcataa atatcaaaag gatttcactt taccgattcg ggaatgtaaa      1080
     aatactatcc ttgaagaggt ttcaaaaata accagtttta acttctatca tccagctact      1140
     gaagaaaata gcattatcaa atcaccggaa attattcctt atcaggatga gcgcttcaga      1200
     ggtgaaaaga ggttccccat taacgcatct ttttttaaag ggtgcgtttc gattttttca      1260
     aatagtattt ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page