(data stored in ACNUC7421 zone)

EMBL: CP000675.PE770

CP000675.PE770       Location/Qualifiers
FT   CDS_pept        complement(835477..836292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2618"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56533"
FT                   /protein_id="ABQ56533.1"
FT                   /translation="MPTIKQMQEFFLNTVLNQQDIAIFEYFCPDEITNEFRFDIYRNTI
FT                   FQNLRHSLEMTFPAIWKLVGKECADGLALHFIQDKNNLPTTHCLDDWGEKFPLFLKNNP
FT                   TVSHLLYLKDIAEIEWLKHLSYCSRDCLVFDPQKLQKHLNDRVEKLILLFNPSVFLYSS
FT                   SYYLKNIFDLIENPTETGSIDFQQIPSYAVISRQKNQTVIHWITHDLFHFLCHIKAGAS
FT                   LGFAYENTLENNPDFDLLTALQFLLRNELLEDSFIHSNYHLTHANNCPE"
     atgcctacaa ttaaacaaat gcaggaattt tttctgaaca cagtattaaa tcaacaagat        60
     attgctattt ttgagtattt ttgccctgac gagattacta atgaattccg tttcgacatt       120
     tatcgtaata ccatttttca gaatctacgc cattccctgg aaatgacttt tccagccatt       180
     tggaaattgg ttggaaaaga atgtgcggat ggtttggctt tacactttat ccaggataaa       240
     aataatttgc caacaaccca ttgtttggat gattggggtg aaaaatttcc tctgttttta       300
     aaaaataatc caaccgttag tcatcttctt tatttgaaag atatcgcaga aatagaatgg       360
     ttaaagcatt taagctattg ctcgcgggat tgtcttgttt ttgatcccca gaaactgcaa       420
     aaacacctaa atgatcgagt agaaaaatta attttgctat ttaatccttc cgtgttttta       480
     tactcatcct cttattactt aaaaaatatt tttgatctga tagaaaatcc cacggaaaca       540
     ggttctattg attttcaaca aataccaagt tatgcggtga tatctcgtca aaaaaatcaa       600
     acagtgattc attggattac tcacgatttg tttcactttt tatgccacat caaagcaggg       660
     gcctcacttg ggttcgcata cgaaaatact ctggaaaata atcccgattt tgatttgctc       720
     actgcattac aatttttact aagaaatgaa ttattggaag attcttttat tcattctaat       780
     tatcatttga ctcacgctaa caactgtcct gaataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page