(data stored in ACNUC7421 zone)

EMBL: CP000675.PE771

CP000675.PE771       Location/Qualifiers
FT   CDS_pept        complement(836279..837112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2617"
FT                   /product="Hypothetical UPF0276 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56532"
FT                   /protein_id="ABQ56532.1"
FT                   /translation="MHKIINGAMTGIGLRAPHYAQILEEKPDIDWLEVHTENFLVKGGP
FT                   LLELLDSISQHYPLSFHGVGLSLGSAEGVCIAHLNRIKTLIDRFQPALLSDHLSWSTIG
FT                   NTYLPDLLPIPYNEESLTIISNNIDRVQNYLKRTLLIENPSSYLEYQTSSYSEPDFLAE
FT                   IIKRTEARLLLDINNIYVSCSNNKRDPYQYIQRIPHEAVQEIHLAGHSIAYQDNTNFLL
FT                   IDTHNNYVCPEVWDLYRYAIHYTGLVPTLLEWDTEIPSLDTLLNEARKSACYAYN"
     atgcataaaa tcataaatgg tgctatgaca ggtattggcc taagagcgcc acattatgcc        60
     caaatattag aggaaaagcc tgatattgat tggcttgaag tacatacaga aaatttcttg       120
     gtcaagggtg ggcctttact agagcttcta gattctataa gccaacatta tccactgagc       180
     tttcatggag tcgggttatc tttagggtct gctgagggag tctgtatagc gcatttaaat       240
     cgcattaaaa ctctcattga ccgctttcaa ccagctttgc tctctgatca tttatcctgg       300
     agtaccatcg gaaacaccta tttacccgat ttattaccta ttccctataa tgaggaaagt       360
     ttgaccatta ttagcaataa tattgataga gtacaaaatt atctaaagag aaccttatta       420
     atagaaaacc cctcttccta tttggaatac cagacctcat cgtattcaga gcctgatttt       480
     ttagcggaaa taatcaagcg tactgaagcc aggctcttat tggatataaa taatatctat       540
     gtttcctgtt ctaataacaa acgagatcct tatcaatata tccaaagaat cccgcatgaa       600
     gcagtacaag aaattcattt ggcgggccat tccattgctt atcaggacaa tacgaatttc       660
     ttgctaatag acacacataa taattatgtg tgtcccgagg tatgggattt gtatcgatat       720
     gcaatacatt atacaggcct tgttcccact ttgttagaat gggatacaga aattccctcg       780
     ttagatactt tattaaatga agccaggaag tcagcctgtt atgcctacaa ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page