(data stored in ACNUC7421 zone)

EMBL: CP000675.PE772

CP000675.PE772       Location/Qualifiers
FT   CDS_pept        837410..837676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2616"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56531"
FT                   /protein_id="ABQ56531.1"
FT                   /translation="MSQNWPTRDKDLQTARVIMEEYANERDSDSLGLFEIVVDQNEKRM
FT                   NFRLSGWVVILAKHFTSLYGVSQGDYVTRQVISRCITQGQTLH"
     atgagtcaaa attggcctac cagagataaa gatttgcaaa cggcgcgagt cataatggaa        60
     gagtatgcta atgaacgtga tagtgattca ttaggtcttt tcgagattgt cgttgatcaa       120
     aatgaaaaac gcatgaattt ccgtttatct ggttgggtag ttattttggc aaaacatttt       180
     acttctttat atggagttag tcagggtgat tacgttacca ggcaggtgat tagtcgctgc       240
     attactcaag gtcaaactct gcattaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page