(data stored in ACNUC7421 zone)

EMBL: CP000675.PE773

CP000675.PE773       Location/Qualifiers
FT   CDS_pept        complement(837920..838672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2615"
FT                   /product="arginine ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56530"
FT                   /protein_id="ABQ56530.1"
FT                   /translation="MKFIQGLLLSFFFLVSPLHAQNEPIPLIIGVGGFYPPFIMQGTNN
FT                   ELFGYDIATMTELCKIMKRQCNFRVMRFRQLIPALINKQIDAAISAMSITSERSNLVNF
FT                   SMPYLLSYSRFLTNEVHNTHQPFNLMLLKGKRIGVEQNTVFSQEIRRMGIIDPVIVEFD
FT                   RTEEMLEALSANKIDFVLMDNPAALYWSANSSGRLLVIGSPMLIGYGLGIAVNRENSVL
FT                   LKSLNDALVEYQRSDKYKENYNKYMMNF"
     atgaaattta ttcagggatt attgctttct ttcttttttc tagtttcacc tctccacgct        60
     caaaacgagc ctataccttt aataataggt gtaggaggct tttacccccc ctttattatg       120
     caaggaacca ataatgagct ttttggctat gatatcgcca ccatgacaga actgtgtaag       180
     ataatgaaac gccaatgtaa ttttcgagtc atgagattca gacaattaat tcctgctctg       240
     attaacaaac aaattgatgc ggcgatcagc gccatgtcta ttacttcaga acgttcaaac       300
     ctggttaatt ttagcatgcc ctatttattg agttactcca ggtttcttac aaatgaggta       360
     cacaatactc atcaaccgtt taatttaatg ctcttaaaag gtaaacgaat tggagtggaa       420
     caaaatactg tctttagtca ggaaatcaga aggatgggga taatagaccc tgtcatagtg       480
     gaatttgaca gaactgaaga aatgcttgag gcgttgagcg caaataaaat tgactttgtt       540
     ctgatggata atcctgccgc tttatactgg tccgctaatt cgtcggggag acttctggta       600
     ataggcagtc ccatgttgat tggttatggt ttgggaattg cagtcaatcg ggaaaactcc       660
     gtattactca aatctctaaa tgatgccttg gtagaatacc agcgttctga caaatacaag       720
     gaaaattaca ataaatacat gatgaatttt taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page